NSBP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NSBP1 Antibody [NBP1-87379] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NSBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVK
Specificity
Specificity of human NSBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMGN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Chromatin Immunoprecipitation
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
ChIP, WB reported in scientific literature (PMID: 23673662). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NSBP1 Protein (NBP1-87379PEP)
Publications
Read Publications using
NBP1-87379 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23673662).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSBP1 Antibody

  • high mobility group nucleosome-binding domain-containing protein 5
  • high-mobility group nucleosome binding domain 5
  • NBP-45
  • NSBP1nucleosomal binding protein 1
  • Nucleosome-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-44687
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P
MMP200
Species: Hu, Mu, Rt, Po, Ca
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-14842
Species: Hu, Po, Bv, Ca, Pm, Rb
Applications: WB
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NBP1-52095
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for NSBP1 Antibody (NBP1-87379)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ChIP, WB.


Filter By Application
ChIP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NSBP1 Antibody (NBP1-87379) (0)

There are no reviews for NSBP1 Antibody (NBP1-87379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for NSBP1 Antibody (NBP1-87379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NSBP1 Products

Bioinformatics Tool for NSBP1 Antibody (NBP1-87379)

Discover related pathways, diseases and genes to NSBP1 Antibody (NBP1-87379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSBP1 Antibody (NBP1-87379)

Discover more about diseases related to NSBP1 Antibody (NBP1-87379).
 

Pathways for NSBP1 Antibody (NBP1-87379)

View related products by pathway.

PTMs for NSBP1 Antibody (NBP1-87379)

Learn more about PTMs related to NSBP1 Antibody (NBP1-87379).
 

Research Areas for NSBP1 Antibody (NBP1-87379)

Find related products by research area.

Blogs on NSBP1

There are no specific blogs for NSBP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGN5