Home » NSBP1 » NSBP1 Antibodies » NSBP1 Antibody

NSBP1 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: NSBP1 Antibody [NBP1-87379] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: NSBP1 Antibody [NBP1-87379] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NSBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVK
Specificity
Specificity of human NSBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMGN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Chromatin Immunoprecipitation
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
ChIP, WB reported in scientific literature (PMID: 23673662). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NSBP1 Protein (NBP1-87379PEP)
Publications
Read Publications using
NBP1-87379 in the following applications:

  • ChIP
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23673662).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSBP1 Antibody

  • high mobility group nucleosome-binding domain-containing protein 5
  • high-mobility group nucleosome binding domain 5
  • NBP-45
  • NSBP1nucleosomal binding protein 1
  • Nucleosome-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - Analysis of a FFPE human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(9 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Cyclin B1 Antibody
(CCNB1/1098)
NBP2-44687
Immunocytochemistry/Immunofluorescence: Cyclin B1 Antibody (CCNB1/1098) [NBP2-44687] - MCF-7 cells stained with CF555 Cyclin B1 Antibody (CCNB1/1098) (nuclei/nucleoli, red) and CF488A phalloidin (actin filaments, green). DNA is stained with Hoechst (blue).
Immunohistochemistry-Paraffin: Cyclin B1 Antibody (CCNB1/1098) [NBP2-44687] - Human Tonsil stained with Cyclin B1 Monoclonal Antibody (CCNB1/1098)
Immunohistochemistry-Paraffin: Cyclin B1 Antibody (CCNB1/1098) [NBP2-44687] - Human Endometrial Carcinoma stained with Cyclin B1 Monoclonal Antibody (CCNB1/1098)
(1 Review)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P
MMP-9 [HRP]
DMP900
(6 Reviews)
(163 Publications)
Species: Hu
MMP-2 [HRP]
MMP200
(1 Review)
(61 Publications)
Species: Hu, Mu, Rt, Po, Ca
Histone H1
Antibody (HH1/957)
NBP2-45184
Immunocytochemistry/Immunofluorescence: Histone H1 Antibody (HH1/957) [NBP2-45184] - Confocal Immunofluorescence image of HeLa cells using Green (CF488) and Phalloidin is used to label the membranes.
Immunohistochemistry-Paraffin: Histone H1 Antibody (HH1/957) [NBP2-45184] - Formalin-fixed, paraffin-embedded human Angiosarcoma stained with Histone H1 Antibody (HH1/957).
Immunocytochemistry/Immunofluorescence: Histone H1 Antibody (HH1/957) [NBP2-45184] - Human cell culture cells were fixed with paraformaldehyde, permeabilised and incubated 1 hour at RT with primary antibody. This image was submitted via customer review.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P
Bax Antibody (6A7)
NBP1-28566
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Total cell lysates from NIH/3T3 cells were resolved by electrophoresis, transferred to PVDF membrane, and probled with Mouse Anti-Bax UNLB.
Immunohistochemistry-Frozen: Bax Antibody (6A7) [NBP1-28566] - Mouse retina with no pretreatment. IHC-F image submitted by a verified customer review
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Analysis of lysates from human metastatic pancreatic cancer cell line L3.6pl using Bax Antibody (clone 6A7; Lot # B168-P780E). This image was submitted via reviews by a varified end user.
(3 Reviews)
(10 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(13 Publications)
Species: Hu
Prolactin Antibody
[Unconjugated]
AF1445
Western blot shows lysates of mouse pituitary tissue and rat pituitary tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse/Rat Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1445) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Prolactin at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Mouse Prolactin (Catalog # 1445-PL) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Rec­ombinant Mouse Prolactin (10 ng/mL) is neutralized (green line) by increasing concen­trations of Goat Anti-Mouse/Rat Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1445). The ND50 is typically 0.25-1.0 µg/mL.
(5 Publications)
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
VEGF [HRP]
DVE00
(25 Reviews)
(509 Publications)
Species: Hu
HMGN1/HMG14
Antibody
NBP2-14842
Western Blot: HMG14 Antibody [NBP2-14842] - Analysis of HMG14 in Daudi lysate in the 1) absence and 2) presence of immunizing peptide probed with 2 ug/ml of HMG14 antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Hu, Po, Bv, Ca, Pm, Rb
Applications: WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Rapamycin reduces mTOR phosphorylation induced by TII. Whole-cell lysates were prepared from astrocytes activated with TII for 2 h. 10 nM Rapamycin was added at the beginning of the experiment and equal amounts of protein were analyzed by western blot for phosphorylated mTOR kinase (p-mTOR) (upper gel) and consequently for beta-actin (lower gel). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-8-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Detection of a 250 kDa band (indicated) corresponding to phosphorylated human mTOR present in a 293T whole cell lysates. Cells were serum-starved for 24 hours prior to harvest. 20 ug of lysate was loaded per lane for SDS-PAGE. Untreated cells are shown in lane 1, whereas cells in lane 2 were treated with IGF-1 (100 ng/ml) for 20 min prior to harvest. Follow reaction of antibody with a 1:2000 dilution of HRP Goat-a-Rabbit IgG for visualization.
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
Recombinant Human
NHC GST (N-Term) Prot ...
H00010473-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Publication)
Species: Hu
TLR4 Antibody
(76B357.1)
NB100-56566
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - Formalin-fixed paraffin-embedded tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, catalog #311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog #NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Pericryptal Myofibroblasts are Responsible for Increased TLR4 Expression in a Subset of CRCs. Double-stained immunofluorescence for TLR4 (green) and vimentin (red) in normal (I), adenoma (II), and colon adenocarcinoma (III) (10x). In the stromal compartment of CRCs, immunofluorescent staining for TLR4 localized to the pericryptal myofibroblasts in a subset of samples. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
Western Blot: TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using 2 ug/ml on (A) human intestine and 6 ug/ml on (B) mouse intestine and C) rat intestine lysate.
(5 Reviews)
(95 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
Septin-4 Antibody
NBP1-52095
Western Blot: Septin-4 Antibody [NBP1-52095] - Staining of Human Heart lysate (35 ug protein in RIPA buffer). Antibody at 1 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Septin-4 Antibody [NBP1-52095] - Staining of paraffin embedded Human Cerebellum. Antibody at 3.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for NSBP1 Antibody (NBP1-87379)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ChIP, WB.


Filter By Application
ChIP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NSBP1 Antibody (NBP1-87379) (0)

There are no reviews for NSBP1 Antibody (NBP1-87379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for NSBP1 Antibody (NBP1-87379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NSBP1 Products

Bioinformatics Tool for NSBP1 Antibody (NBP1-87379)

Discover related pathways, diseases and genes to NSBP1 Antibody (NBP1-87379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSBP1 Antibody (NBP1-87379)

Discover more about diseases related to NSBP1 Antibody (NBP1-87379).
 

Pathways for NSBP1 Antibody (NBP1-87379)

View related products by pathway.

PTMs for NSBP1 Antibody (NBP1-87379)

Learn more about PTMs related to NSBP1 Antibody (NBP1-87379).
 

Research Areas for NSBP1 Antibody (NBP1-87379)

Find related products by research area.

Blogs on NSBP1

There are no specific blogs for NSBP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSBP1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HMGN5