NSBP1 Antibody

Immunocytochemistry/Immunofluorescence: NSBP1 Antibody [NBP1-87379] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human prostate shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: NSBP1 Antibody [NBP1-87379] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NSBP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HMGN5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP)
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ChIP, WB reported in scientific literature (PMID: 23673662). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NSBP1 Protein (NBP1-87379PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23673662).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NSBP1 Antibody

• high mobility group nucleosome-binding domain-containing protein 5
• high-mobility group nucleosome binding domain 5
• NBP-45
• NSBP1nucleosomal binding protein 1
• Nucleosome-binding protein 1

Background

The NSBP1 gene encodes a nuclear protein with similarities to the high mobility group proteins, HMG14 and HMG17, whichsuggests that this protein may function as a nucleosomal binding and transcriptional activating protein. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NSBP1 Antibody (NBP1-87379)(2)

Publications using NBP1-87379

• Zhang S, Schones DE, Malicet C et al. High Mobility Group Protein N5 (HMGN5) and Lamina-associated Polypeptide 2alpha (LAP2alpha) Interact and Reciprocally Affect Their Genome-wide Chromatin Organization. J Biol Chem 2013-06-21 [PMID: 23673662] (WB, Chemotaxis, Human)
• Malicet C, Rochman M, Postnikov Y et al. Distinct properties of human HMGN5 reveal a rapidly evolving but functionally conserved nucleosome binding protein. Mol Cell Biol 2011-07-01 [PMID: 21518955]

Bioinformatics

• Gene Symbol: HMGN5