Recombinant Human NHC GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human NHC GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32874 of Human HMGN4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
HMGN4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00010473-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NHC GST (N-Term) Protein

  • high mobility group nucleosomal binding domain 4
  • high mobility group protein N4
  • high-mobility group (nonhistone chromosomal) protein 17-like 3
  • high-mobility group protein 17-like 3
  • HMG17L3
  • MGC5145
  • NHChigh mobility group nucleosome-binding domain-containing protein 4
  • Non-histone chromosomal protein HMG-17-like 3
  • Non-histone chromosomal protein

Background

HMGN4( AAH01282, 1 a.a. - 91 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87379
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-76801
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
H00003151-P01
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for NHC Recombinant Protein (H00010473-P01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00010473-P01 Applications Species
Bonfiglio JJ, Fontana P, Zhang Q et al. Serine ADP-Ribosylation Depends on HPF1. Mol Cell 2017-02-08 [PMID: 28190768]

Reviews for NHC Recombinant Protein (H00010473-P01) (0)

There are no reviews for NHC Recombinant Protein (H00010473-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHC Recombinant Protein (H00010473-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NHC Products

Array H00010473-P01

Bioinformatics Tool for NHC Recombinant Protein (H00010473-P01)

Discover related pathways, diseases and genes to NHC Recombinant Protein (H00010473-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHC Recombinant Protein (H00010473-P01)

Discover more about diseases related to NHC Recombinant Protein (H00010473-P01).
 

Pathways for NHC Recombinant Protein (H00010473-P01)

View related products by pathway.

Blogs on NHC

There are no specific blogs for NHC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NHC GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGN4