NHC Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

NHC Recombinant Protein Summary

Description
NHC (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
Preparation
Method
in vitro wheat germ expression system
Gene
HMGN4

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NHC Recombinant Protein

  • high mobility group nucleosomal binding domain 4
  • high mobility group protein N4
  • high-mobility group (nonhistone chromosomal) protein 17-like 3
  • high-mobility group protein 17-like 3
  • HMG17L3
  • MGC5145
  • NHChigh mobility group nucleosome-binding domain-containing protein 4
  • Non-histone chromosomal protein HMG-17-like 3
  • Non-histone chromosomal protein

Background

HMGN4( AAH01282, 1 a.a. - 91 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87379
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76801
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-98427
Species: Mu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42855
Species: Hu, Mu
Applications: WB
H00010473-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NHC Recombinant Protein (H00010473-P01) (0)

There are no publications for NHC Recombinant Protein (H00010473-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHC Recombinant Protein (H00010473-P01) (0)

There are no reviews for NHC Recombinant Protein (H00010473-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHC Recombinant Protein (H00010473-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NHC Recombinant Protein Products

NHC H00010473-P01

Related Products by Gene

Bioinformatics Tool for NHC Recombinant Protein (H00010473-P01)

Discover related pathways, diseases and genes to NHC Recombinant Protein (H00010473-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHC Recombinant Protein (H00010473-P01)

Discover more about diseases related to NHC Recombinant Protein (H00010473-P01).
 

Pathways for NHC Recombinant Protein (H00010473-P01)

View related products by pathway.

Blogs on NHC

There are no specific blogs for NHC, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol HMGN4

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00010473-P01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

NHC RNAi
H00010473-R01-20nmol
AAAS Antibody (5A1)
H00008086-M02
AAAS Antibody (5A1)
H00008086-M02
AAAS Antibody (5A1)
H00008086-M02