Recombinant Human NHC Protein (H00010473-P01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NHC Protein Summary

Description
NHC (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
HMGN4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00010473-P01.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NHC Protein

  • high mobility group nucleosomal binding domain 4
  • high mobility group protein N4
  • high-mobility group (nonhistone chromosomal) protein 17-like 3
  • high-mobility group protein 17-like 3
  • HMG17L3
  • MGC5145
  • NHChigh mobility group nucleosome-binding domain-containing protein 4
  • Non-histone chromosomal protein HMG-17-like 3
  • Non-histone chromosomal protein

Background

HMGN4( AAH01282, 1 a.a. - 91 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87379
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76801
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
H00010473-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NHC Recombinant Protein (H00010473-P01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00010473-P01 Applications Species
Bonfiglio JJ, Fontana P, Zhang Q et al. Serine ADP-Ribosylation Depends on HPF1. Mol Cell 2017 Mar 2 [PMID: 28190768]

Reviews for NHC Recombinant Protein (H00010473-P01) (0)

There are no reviews for NHC Recombinant Protein (H00010473-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHC Recombinant Protein (H00010473-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NHC Products

NHC H00010473-P01

Related Products by Gene

Bioinformatics Tool for NHC Recombinant Protein (H00010473-P01)

Discover related pathways, diseases and genes to NHC Recombinant Protein (H00010473-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHC Recombinant Protein (H00010473-P01)

Discover more about diseases related to NHC Recombinant Protein (H00010473-P01).
 

Pathways for NHC Recombinant Protein (H00010473-P01)

View related products by pathway.

Blogs on NHC

There are no specific blogs for NHC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NHC RNAi
H00010473-R01-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NHC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGN4