NRBP1 Antibody

Images

 
Western Blot: NRBP1 Antibody [NBP1-88679] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: NRBP1 Antibody [NBP1-88679] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STTSAASPEEEEESEDESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADIKENKARVIFITEYMSSGSLKQFLKKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NRBP1 Protein (NBP1-88679PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NRBP1 Antibody

  • BCON3NRBPMADM
  • FLJ27109
  • FLJ35541
  • MUDPNP
  • multiple domain putative nuclear protein
  • myeloid leukemia factor 1 adaptor molecule
  • nuclear receptor binding protein 1
  • nuclear receptor binding protein
  • nuclear receptor-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-02052
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP2-32058
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
AF3444
Species: Hu
Applications: WB
NBP1-85657
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
H00057167-M03
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NBP1-87132
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-88679
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NRBP1 Antibody (NBP1-88679) (0)

There are no publications for NRBP1 Antibody (NBP1-88679).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRBP1 Antibody (NBP1-88679) (0)

There are no reviews for NRBP1 Antibody (NBP1-88679). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NRBP1 Antibody (NBP1-88679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRBP1 Products

Bioinformatics Tool for NRBP1 Antibody (NBP1-88679)

Discover related pathways, diseases and genes to NRBP1 Antibody (NBP1-88679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRBP1 Antibody (NBP1-88679)

Discover more about diseases related to NRBP1 Antibody (NBP1-88679).
 

Pathways for NRBP1 Antibody (NBP1-88679)

View related products by pathway.

PTMs for NRBP1 Antibody (NBP1-88679)

Learn more about PTMs related to NRBP1 Antibody (NBP1-88679).
 

Research Areas for NRBP1 Antibody (NBP1-88679)

Find related products by research area.

Blogs on NRBP1

There are no specific blogs for NRBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NRBP1