NRAP Antibody (1E9)

Images

 
Sandwich ELISA: NRAP Antibody (1E9) [H00004892-M01] - Detection limit for recombinant GST tagged NRAP is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NRAP Antibody (1E9) Summary

Immunogen
NRAP (NP_932326.2 1640 a.a. - 1727 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGSYKVEMARRAAELANARGLGLQGAYRGAEAVEAGDHQSGEVNPDATEILHVKKKKA
Specificity
This product is specific for Human NRAP monoclonal antibody (M01), clone 1E9 [Gene ID: 4892].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NRAP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NRAP Antibody (1E9)

  • nebulin-related anchoring protein
  • nebulin-related-anchoring protein
  • N-RAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11099
Species: Hu, Mu, Rt, Po, Al, Am, Av, Bv, Ch, Fi, Rb
Applications: WB, ICC/IF
NBP1-80786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NBP1-45223
Species: Hu, Mu, Ca
Applications: IHC, IHC-P, PEP-ELISA
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, Single Cell Western
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, ICC
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP2-19562
Species: Hu, Mu
Applications: WB, ICC/IF
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB4470
Species: Multi
Applications: WB, IHC, ICC
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25221
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30249
Species: Hu, Mu, Xp
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-89300
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for NRAP Antibody (H00004892-M01) (0)

There are no publications for NRAP Antibody (H00004892-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRAP Antibody (H00004892-M01) (0)

There are no reviews for NRAP Antibody (H00004892-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NRAP Antibody (H00004892-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NRAP Products

Array H00004892-M01

Bioinformatics Tool for NRAP Antibody (H00004892-M01)

Discover related pathways, diseases and genes to NRAP Antibody (H00004892-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRAP Antibody (H00004892-M01)

Discover more about diseases related to NRAP Antibody (H00004892-M01).
 

Pathways for NRAP Antibody (H00004892-M01)

View related products by pathway.

PTMs for NRAP Antibody (H00004892-M01)

Learn more about PTMs related to NRAP Antibody (H00004892-M01).

Blogs on NRAP

There are no specific blogs for NRAP, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRAP Antibody (1E9) and receive a gift card or discount.

Bioinformatics

Gene Symbol NRAP
Uniprot
COVID-19 update