NRAP Antibody (1E9) - Azide and BSA Free

Sandwich ELISA: NRAP Antibody (1E9) [H00004892-M01] - Detection limit for recombinant GST tagged NRAP is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NRAP Antibody (1E9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: NRAP (NP_932326.2, 1640 a.a. ~ 1727 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGSYKVEMARRAAELANARGLGLQGAYRGAEAVEAGDHQSGEVNPDATEILHVKKKKA
• Specificity: This product is specific for Human NRAP monoclonal antibody (M01), clone 1E9 [Gene ID: 4892].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NRAP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NRAP Antibody (1E9) - Azide and BSA Free

• nebulin-related anchoring protein
• nebulin-related-anchoring protein
• N-RAP

Background

NRAP may be involved in anchoring the terminal actin filaments in the myofibril to the membrane and in transmitting tension from the myofibrils to the extracellular matrix

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NRAP
• Uniprot:
  • NP_932326.2(Human)