NRAGE/MAGED1 Antibody

Images

 
Genetic Strategies: Western Blot: NRAGE/MAGED1 Antibody [NBP2-55005] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Immunocytochemistry/ Immunofluorescence: NRAGE/MAGED1 Antibody [NBP2-55005] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

NRAGE/MAGED1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAANKSEMAFKAQNATTKVGPNATYNFSQSLNANDLANSRPKTPFKAWNDTTKAPTADTQTQNVNQAKMATSQADIETDPGISEP
Specificity
Specificity of human NRAGE/MAGED1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGED1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NRAGE/MAGED1 Recombinant Protein Antigen (NBP2-55005PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NRAGE/MAGED1 Antibody

  • Dlxin-1
  • MAGE tumor antigen CCF
  • MAGED1
  • melanoma antigen family D, 1
  • melanoma-associated antigen D1
  • Neurotrophin receptor-interacting MAGE homolog
  • NRAGE MAGE-D1 antigen
  • NRAGE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
H00004692-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-85445
Species: Hu
Applications: WB, IHC, IHC-P
H00026574-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP1-85793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48653
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56183
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MMP200
Species: Hu, Mu, Rt, Po, Ca
NBP2-55005
Species: Hu
Applications: WB, ICC/IF, KD

Publications for NRAGE/MAGED1 Antibody (NBP2-55005) (0)

There are no publications for NRAGE/MAGED1 Antibody (NBP2-55005).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRAGE/MAGED1 Antibody (NBP2-55005) (0)

There are no reviews for NRAGE/MAGED1 Antibody (NBP2-55005). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NRAGE/MAGED1 Antibody (NBP2-55005) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NRAGE/MAGED1 Products

Bioinformatics Tool for NRAGE/MAGED1 Antibody (NBP2-55005)

Discover related pathways, diseases and genes to NRAGE/MAGED1 Antibody (NBP2-55005). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRAGE/MAGED1 Antibody (NBP2-55005)

Discover more about diseases related to NRAGE/MAGED1 Antibody (NBP2-55005).
 

Pathways for NRAGE/MAGED1 Antibody (NBP2-55005)

View related products by pathway.

PTMs for NRAGE/MAGED1 Antibody (NBP2-55005)

Learn more about PTMs related to NRAGE/MAGED1 Antibody (NBP2-55005).
 

Research Areas for NRAGE/MAGED1 Antibody (NBP2-55005)

Find related products by research area.

Blogs on NRAGE/MAGED1

There are no specific blogs for NRAGE/MAGED1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRAGE/MAGED1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGED1