NRAGE/MAGED1 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAANKSEMAFKAQNATTKVGPNATYNFSQSLNANDLANSRPKTPFKAWNDTTKAPTADTQTQNVNQAKMATSQADIETDPGISEP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MAGED1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Knockdown Validated
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for NRAGE/MAGED1 Antibody - BSA Free
Background
MAGED1 is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. MAGED1 has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Publications for NRAGE/MAGED1 Antibody (NBP2-55005) (0)
There are no publications for NRAGE/MAGED1 Antibody (NBP2-55005).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NRAGE/MAGED1 Antibody (NBP2-55005) (0)
There are no reviews for NRAGE/MAGED1 Antibody (NBP2-55005).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NRAGE/MAGED1 Antibody (NBP2-55005) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NRAGE/MAGED1 Products
Research Areas for NRAGE/MAGED1 Antibody (NBP2-55005)
Find related products by research area.
|
Blogs on NRAGE/MAGED1