Home » Necdin » Necdin Antibodies » Necdin Antibody (1B3)

Necdin Antibody (1B3)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Necdin Antibody (1B3) [H00004692-M02] - NDN monoclonal antibody (M02), clone 1B3 Analysis of NDN expression in HL-60.
Western Blot: Necdin Antibody (1B3) [H00004692-M02] - NDN monoclonal antibody (M02), clone 1B3 Analysis of NDN expression in HL-60.
Immunocytochemistry/ Immunofluorescence: Necdin Antibody (1B3) [H00004692-M02] - Analysis of monoclonal antibody to NDN on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Necdin Antibody (1B3) [H00004692-M02] - Analysis of monoclonal antibody to NDN on formalin-fixed paraffin-embedded human colon. Antibody concentration 1.5 ug/ml.
Western Blot: Necdin Antibody (1B3) [H00004692-M02] - Analysis of NDN over-expressed 293 cell line, cotransfected with NDN Validated Chimera RNAi ( Cat # H00004692-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: Necdin Antibody (1B3) [H00004692-M02] - Analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M02), clone 1B3.Lane 1: NDN transfected lysate(36.1 KDa).Lane 2: Non-transfected ...read more
ELISA: Necdin Antibody (1B3) [H00004692-M02] - Detection limit for recombinant GST tagged NDN is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, RNAi
Clone
1B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Necdin Antibody (1B3) Summary

Immunogen
NDN (NP_002478 222 a.a. - 321 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
Specificity
NDN - necdin homolog (mouse)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.
Publications
Read Publication using H00004692-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Necdin Antibody (1B3)

  • HsT16328
  • necdin (mouse) homolog
  • necdin homolog (mouse)
  • necdin
  • PWCR

Background

This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SNRPN Antibody
NBP2-20439
Western Blot: SNRPN Antibody [NBP2-20439] - Sample (50 ug of whole cell lysate) A: Mouse Heart, 12% SDS PAGE gel, diluted at 1:500.
Western Blot: SNRPN Antibody [NBP2-20439] - Sample (30 ug of whole cell lysate) A: JurKat 12% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NRAGE/MAGED1
Antibody (613441)
MAB38352
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and L6 rat myoblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human NRAGE Monoclonal Antibody (Catalog # MAB38352) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for NRAGE at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
NRAGE was detected in immersion fixed C2C12 mouse myoblast cell line using Mouse Anti-Human NRAGE Monoclonal Antibody (Catalog # MAB38352) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu
Applications: WB, ICC
MAGEL2 Antibody
NBP1-02509
Immunohistochemistry-Paraffin: MAGEL2 Antibody [NBP1-02509] - Staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, IHC, IHC-P
MKRN3 Antibody
NBP1-84320
Western Blot: MKRN3 Antibody [NBP1-84320] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-343
Immunocytochemistry/Immunofluorescence: MKRN3 Antibody [NBP1-84320] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: MKRN3 Antibody [NBP1-84320] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
IGF-II
292-G2
1 μg/lane of Recombinant Human IGF-II was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-II (Catalog # 292‑G2) stimulates cell proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 1.5‑6 ng/mL.
(1 Review)
(30 Publications)
Species: Hu
E6AP/UBE3A Antibody
NB500-240
Western Blot: E6AP/UBE3A Antibody [NB500-240] - UBE3A Antibody [NB500-240] - Samples: Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg), and mouse NIH3T3 (M; 50 mcg) cells. Antibodies: Affinity purified rabbit anti-E6AP antibody used for WB at 0.4 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate. E6AP was also immunoprecipitated by rabbit anti-E6AP antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 3 minutes (A and B).
(8 Publications)
Species: Hu, Mu
Applications: WB, IP
NGF
R/TNFRSF16/p75NTR Ant
MAB367
NGF R/TNFRSF16 was detected in immersion fixed canine mesenchymal stem cells using Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
NGF R/TNFRSF16 was detected in immersion fixed human mesenchymal stem cells using Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
NGF R/TNFRSF16 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using 25 µg/mL Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Publications)
Species: Hu, Ca
Applications: WB, IHC, ICC
E2F-1 Antibody
(8G9)
NBP2-37474
Western Blot: E2F-1 Antibody (8G9) [NBP2-37474] - Western blot analysis using E2F1 mouse mAb against HeLa (1), SK-N-SH (2), and NIH3T3 (3) cell lysate.
Immunohistochemistry-Paraffin: E2F-1 Antibody (8G9) [NBP2-37474] - Immunohistochemical analysis of paraffin-embedded rectum cancer tissues using E2F1 mouse mAb with DAB staining.
Flow Cytometry: E2F-1 Antibody (8G9) [NBP2-37474] - Flow cytometric analysis of HeLa cells using E2F1 mouse mAb (green) and negative control (red).
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
MEST Antibody
NBP1-44050
Western Blot: MEST Antibody [NBP1-44050] - NBP1-44050 (0.2ug/ml) staining of Mouse Testis lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Mu, Rt
Applications: WB, PEP-ELISA
RNF4 Knockout HeLa
Cell Lysate
NBP2-65126
RNF4 Knockout HeLa Cell Lysate
Species: Hu
SNURF Antibody
H00008926-B01P
Western Blot: SNURF Antibody [H00008926-B01P] - Analysis of SNURF expression in transfected 293T cell line by SNURF polyclonal antibody. Lane 1: SNURF transfected lysate(26.51 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: SNURF Antibody [H00008926-B01P] - Analysis of purified antibody to SNURF on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF
Sirtuin 1/SIRT1
Antibody (1F3)
NBP1-51641
Western Blot: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Western blot analysis using SIRT1 mouse mAb against MCF-7 (1), Jurkat (2), Hela (3), HEK293 (4) and A549 (5) cell lysates.
Immunocytochemistry/Immunofluorescence: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - SIRT1 antibody was tested at 1:10 in Ntera2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x.
Immunohistochemistry-Paraffin: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Immunohistochemical analysis of paraffin-embedded lung cancer tissues (left) and kidney cancer tissues (right) using SIRT1 mouse mAb with DAB staining.
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
MSX2 Antibody
NBP1-85445
Western Blot: MSX2 Antibody [NBP1-85445] - Analysis in human cell line BEWO.
Immunohistochemistry-Paraffin: MSX2 Antibody [NBP1-85445] - Staining of human placenta shows distinct nuclear positivity in trophoblastic cells.
Western Blot: MSX2 Antibody [NBP1-85445] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Blood group H
inhibitor Antibody
NBP1-57016
Western Blot: Blood group H inhibitor Antibody [NBP1-57016] - Human Heart lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
BDNF [Unconjugated]
248-BD
1 μg/lane of Recombinant Human BDNF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human BDNF (Catalog #248‑BD) stimulates cell proliferation in the BaF mouse pro-B cell line transfected with TrkB. The ED50 for this effect is 0.2-2 ng/mL.
(6 Reviews)
(96 Publications)
Species: Hu, Mu, Rt, Ca, Eq
p57 Kip2 Antibody
NBP1-89917
Western Blot: p57 Kip2 Antibody [NBP1-89917] - Analysis in human placenta tissue.
Immunocytochemistry/Immunofluorescence: p57 Kip2 Antibody [NBP1-89917] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining in human placenta and colon tissues using anti-CDKN1C antibody. Corresponding CDKN1C RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PEG3 Antibody
NBP2-47624
Western Blot: PEG3 Antibody [NBP2-47624] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line HepG2.
Immunocytochemistry/Immunofluorescence: PEG3 Antibody [NBP2-47624] - Staining human cell line Hep G2 shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEG3 Antibody [NBP2-47624] - Staining of human placenta shows strong nuclear positivity in trophoblastic in trophoblastic cells and decidua cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Necdin Antibody (H00004692-M02)(1)


Reviews for Necdin Antibody (H00004692-M02) (0)

There are no reviews for Necdin Antibody (H00004692-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Necdin Antibody (H00004692-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Necdin Products

Bioinformatics Tool for Necdin Antibody (H00004692-M02)

Discover related pathways, diseases and genes to Necdin Antibody (H00004692-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Necdin Antibody (H00004692-M02)

Discover more about diseases related to Necdin Antibody (H00004692-M02).
 

Pathways for Necdin Antibody (H00004692-M02)

View related products by pathway.

PTMs for Necdin Antibody (H00004692-M02)

Learn more about PTMs related to Necdin Antibody (H00004692-M02).
 

Research Areas for Necdin Antibody (H00004692-M02)

Find related products by research area.

Blogs on Necdin

There are no specific blogs for Necdin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Necdin Antibody (1B3) and receive a gift card or discount.


Bioinformatics

Gene Symbol NDN
Entrez
OMIM
Uniprot