Necdin Antibody (1B3)

Images

 
Western Blot: Necdin Antibody (1B3) [H00004692-M02] - NDN monoclonal antibody (M02), clone 1B3 Analysis of NDN expression in HL-60.
Immunocytochemistry/ Immunofluorescence: Necdin Antibody (1B3) [H00004692-M02] - Analysis of monoclonal antibody to NDN on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Necdin Antibody (1B3) [H00004692-M02] - Analysis of monoclonal antibody to NDN on formalin-fixed paraffin-embedded human colon. Antibody concentration 1.5 ug/ml.
Western Blot: Necdin Antibody (1B3) [H00004692-M02] - Analysis of NDN over-expressed 293 cell line, cotransfected with NDN Validated Chimera RNAi ( Cat # H00004692-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: Necdin Antibody (1B3) [H00004692-M02] - Analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M02), clone 1B3.Lane 1: NDN transfected lysate(36.1 KDa).Lane 2: Non-transfected ...read more
ELISA: Necdin Antibody (1B3) [H00004692-M02] - Detection limit for recombinant GST tagged NDN is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, RNAi
Clone
1B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Necdin Antibody (1B3) Summary

Immunogen
NDN (NP_002478 222 a.a. - 321 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
Specificity
NDN - necdin homolog (mouse)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.
Publications
Read Publication using H00004692-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Necdin Antibody (1B3)

  • HsT16328
  • necdin (mouse) homolog
  • necdin homolog (mouse)
  • necdin
  • PWCR

Background

This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB38352
Species: Hu, Mu
Applications: WB, ICC
NBP1-02509
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-84320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-240
Species: Hu, Mu
Applications: WB, IP
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
H00006047-A01
Species: Hu
Applications: WB, ELISA
H00008926-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Necdin Antibody (H00004692-M02)(1)

Reviews for Necdin Antibody (H00004692-M02) (0)

There are no reviews for Necdin Antibody (H00004692-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Necdin Antibody (H00004692-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Necdin Products

Bioinformatics Tool for Necdin Antibody (H00004692-M02)

Discover related pathways, diseases and genes to Necdin Antibody (H00004692-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Necdin Antibody (H00004692-M02)

Discover more about diseases related to Necdin Antibody (H00004692-M02).
 

Pathways for Necdin Antibody (H00004692-M02)

View related products by pathway.

PTMs for Necdin Antibody (H00004692-M02)

Learn more about PTMs related to Necdin Antibody (H00004692-M02).
 

Research Areas for Necdin Antibody (H00004692-M02)

Find related products by research area.

Blogs on Necdin

There are no specific blogs for Necdin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Necdin Antibody (1B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDN
Entrez
OMIM
Uniprot