NR4A3/NOR1 Antibody (1E11.)

Images

 
Western Blot: NR4A3/NOR1 Antibody (1E11) [H00008013-M06] - Analysis of monoclonal antibody to NR4A3 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: NR4A3/NOR1 Antibody (1E11) [H00008013-M06] - Western Blot analysis of NR4A3 expression in Hela NE ( Cat # L013V3 ).
Sandwich ELISA: NR4A3/NOR1 Antibody (1E11) [H00008013-M06] - Detection limit for recombinant GST tagged NR4A3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
1E11.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NR4A3/NOR1 Antibody (1E11.) Summary

Immunogen
NR4A3 (NP_008912 414 a.a. - 521 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFS
Specificity
NR4A3 - nuclear receptor subfamily 4, group A, member 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NR4A3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
Application Notes
This antibody reactivity against cell lysate and recombinant protein for WB. It has been useful for IF and ELISA. IHC usage reported in scientific literature (PMID: 23390133).
Publications
Read Publications using H00008013-M06.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NR4A3/NOR1 Antibody (1E11.)

  • CHN
  • CSMF
  • MINOR
  • NOR1
  • TEC

Background

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between this gene and other genes. The translocation breakpoints are associated with Nuclear Receptor Subfamily 4, Group A, Member 3 (on chromosome 9) and either Ewing Sarcome Breakpoint Region 1 (on chromosome 22), RNA Polymerase II, TATA Box-Binding Protein-Associated Factor, 68-KD (on chromosome 17), or Transcription factor 12 (on chromosome 15). Four transcript variants encoding three distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
AF2156
Species: Hu, Mu
Applications: WB, IHC
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
796-IC
Species: Mu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for NR4A3/NOR1 Antibody (H00008013-M06)(3)

Reviews for NR4A3/NOR1 Antibody (H00008013-M06) (0)

There are no reviews for NR4A3/NOR1 Antibody (H00008013-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NR4A3/NOR1 Antibody (H00008013-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NR4A3/NOR1 Products

Bioinformatics Tool for NR4A3/NOR1 Antibody (H00008013-M06)

Discover related pathways, diseases and genes to NR4A3/NOR1 Antibody (H00008013-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NR4A3/NOR1 Antibody (H00008013-M06)

Discover more about diseases related to NR4A3/NOR1 Antibody (H00008013-M06).
 

Pathways for NR4A3/NOR1 Antibody (H00008013-M06)

View related products by pathway.

PTMs for NR4A3/NOR1 Antibody (H00008013-M06)

Learn more about PTMs related to NR4A3/NOR1 Antibody (H00008013-M06).

Blogs on NR4A3/NOR1

There are no specific blogs for NR4A3/NOR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NR4A3/NOR1 Antibody (1E11.) and receive a gift card or discount.

Bioinformatics

Gene Symbol NR4A3
Entrez
OMIM
Uniprot