NPDC-1 Antibody

Images

 
Western Blot: NPDC-1 Antibody [NBP1-86693] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: NPDC-1 Antibody [NBP1-86693] - Staining of human cell line A-431 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: NPDC-1 Antibody [NBP1-86693] - Staining of human duodenum shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPDC-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NPDC-1 Protein (NBP1-86693PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPDC-1 Antibody

  • CAB-
  • CAB1
  • CAB-1
  • CAB1CAB
  • DKFZp586J0523
  • neural proliferation differentiation and control protein 1
  • neural proliferation, differentiation and control, 1
  • NPDC1
  • NPDC-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-86589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000783-M05
Species: Hu, Mu
Applications: WB, ELISA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-86693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NPDC-1 Antibody (NBP1-86693) (0)

There are no publications for NPDC-1 Antibody (NBP1-86693).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPDC-1 Antibody (NBP1-86693) (0)

There are no reviews for NPDC-1 Antibody (NBP1-86693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NPDC-1 Antibody (NBP1-86693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPDC-1 Products

Bioinformatics Tool for NPDC-1 Antibody (NBP1-86693)

Discover related pathways, diseases and genes to NPDC-1 Antibody (NBP1-86693). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPDC-1 Antibody (NBP1-86693)

Discover more about diseases related to NPDC-1 Antibody (NBP1-86693).
 

Pathways for NPDC-1 Antibody (NBP1-86693)

View related products by pathway.

PTMs for NPDC-1 Antibody (NBP1-86693)

Learn more about PTMs related to NPDC-1 Antibody (NBP1-86693).

Blogs on NPDC-1

There are no specific blogs for NPDC-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPDC-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPDC1
Entrez