NOS1AP Antibody - BSA Free

Western Blot: NOS1AP Antibody [NBP2-38758] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue

Staining of human hippocampus shows moderate cytoplasmic positivity in neurons.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in a subset of neurons.

Staining of human kidney shows strong membranous positivity in cells in glomeruli.

NOS1AP Antibody [NBP2-38758] -

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NOS1AP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDV
• Predicted Species: Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOS1AP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NOS1AP Recombinant Protein Antigen (NBP2-38758PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NOS1AP Antibody - BSA Free

• 6330408P19Rik
• CAPONMGC138500
• carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
• C-terminal PDZ ligand of neuronal nitric oxide synthase protein
• KIAA0464C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON)
• ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain
• nitric oxide synthase 1 (neuronal) adaptor protein
• Nitric oxide synthase 1 adaptor protein

Background

NOS1AP encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NOS1AP Antibody (NBP2-38758)(1)

Publication using NBP2-38758

• Majmundar AJ, Buerger F, Forbes TA, et al. Recessive NOS1AP variants impair actin remodeling and cause glomerulopathy in humans and mice Science advances 2021-01-01 [PMID: 33523862] (Human)

Bioinformatics

• Gene Symbol: NOS1AP
• Uniprot:
  • O75052(Human)