Calsequestrin 2 Antibody

Images

 
Western Blot: Calsequestrin 2 Antibody [NBP1-87304] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-93
Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human skin shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining in human heart muscle and skin tissues using anti-CASQ2 antibody. Corresponding CASQ2 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human heart muscle, lymph node, skeletal muscle and skin using Anti-CASQ2 antibody NBP1-87304 (A) shows ...read more
Immunohistochemistry-Paraffin: Calsequestrin 2 Antibody [NBP1-87304] - Staining of human lymph node.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calsequestrin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVL
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CASQ2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Calsequestrin 2 Protein (NBP1-87304PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calsequestrin 2 Antibody

  • calsequestrin 2 (cardiac muscle)
  • calsequestrin 2, fast-twitch, cardiac muscle
  • Calsequestrin, cardiac muscle isoform
  • calsequestrin-2
  • FLJ26321
  • FLJ93514
  • PDIB2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6387
Species: Hu
Applications: WB
NB120-3516
Species: Hu, Mu, Rt, Ca, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-76961
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, ICC/IF, IHC, IHC-P
NBP1-87417
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87304
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69229
Species: Hu
Applications: WB
NBP2-19807
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86990
Species: Hu, Mu
Applications: WB, ICC/IF, KD
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-12900
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NBP2-38151
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003753-M01
Species: Hu, Rt, Ca, Gp, Pm
Applications: WB, ELISA, ICC/IF, KD
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP2-38146
Species: Hu
Applications: IHC, IHC-P

Publications for Calsequestrin 2 Antibody (NBP1-87304) (0)

There are no publications for Calsequestrin 2 Antibody (NBP1-87304).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calsequestrin 2 Antibody (NBP1-87304) (0)

There are no reviews for Calsequestrin 2 Antibody (NBP1-87304). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calsequestrin 2 Antibody (NBP1-87304) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Calsequestrin 2 Products

Bioinformatics Tool for Calsequestrin 2 Antibody (NBP1-87304)

Discover related pathways, diseases and genes to Calsequestrin 2 Antibody (NBP1-87304). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calsequestrin 2 Antibody (NBP1-87304)

Discover more about diseases related to Calsequestrin 2 Antibody (NBP1-87304).
 

Pathways for Calsequestrin 2 Antibody (NBP1-87304)

View related products by pathway.

PTMs for Calsequestrin 2 Antibody (NBP1-87304)

Learn more about PTMs related to Calsequestrin 2 Antibody (NBP1-87304).

Blogs on Calsequestrin 2

There are no specific blogs for Calsequestrin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calsequestrin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CASQ2