NONO Antibody

Images

 
Western Blot: NONO Antibody [NBP2-38716] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP2-38716] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry: NONO Antibody [NBP2-38716] - Staining of human heart muscle shows strong nuclear positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NONO Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLG
Specificity
Specificity of human NONO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NONO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NONO Protein (NBP2-38716PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NONO Antibody

  • NMT5552 kDa subunit
  • non-POU domain containing, octamer-binding
  • NRB54non-POU-domain-containing, octamer-binding
  • p54(nrb)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20329
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1334
Species: Hu
Applications: WB, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB200-191
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-83801
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-38716
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NONO Antibody (NBP2-38716) (0)

There are no publications for NONO Antibody (NBP2-38716).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NONO Antibody (NBP2-38716) (0)

There are no reviews for NONO Antibody (NBP2-38716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NONO Antibody (NBP2-38716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NONO Antibody (NBP2-38716)

Discover related pathways, diseases and genes to NONO Antibody (NBP2-38716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NONO Antibody (NBP2-38716)

Discover more about diseases related to NONO Antibody (NBP2-38716).
 

Pathways for NONO Antibody (NBP2-38716)

View related products by pathway.

PTMs for NONO Antibody (NBP2-38716)

Learn more about PTMs related to NONO Antibody (NBP2-38716).
 

Research Areas for NONO Antibody (NBP2-38716)

Find related products by research area.

Blogs on NONO

There are no specific blogs for NONO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NONO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NONO
Uniprot