non-muscle Myosin IIA Antibody

Images

 
Western Blot: non-muscle Myosin IIA Antibody [NBP2-62644] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: non-muscle Myosin IIA Antibody [NBP2-62644] - Staining of human cell line A-431 shows localization to nuclear bodies, plasma membrane & actin filaments. Antibody staining is ...read more
Immunohistochemistry-Paraffin: non-muscle Myosin IIA Antibody [NBP2-62644] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: non-muscle Myosin IIA Antibody [NBP2-62644] - Immunohistochemistry analysis in human gallbladder and pancreas tissues using Anti-MYH9 antibody. Corresponding MYH9 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: non-muscle Myosin IIA Antibody [NBP2-62644] - Staining of human gallbladder shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

non-muscle Myosin IIA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYH9
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
non-muscle Myosin IIA Recombinant Protein Antigen (NBP2-62644PEP)

Reactivity Notes

Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for non-muscle Myosin IIA Antibody

  • Cellular myosin heavy chain, type A
  • DFNA17
  • EPSTS
  • FTNSNMMHC-IIA
  • MGC104539
  • MHANMMHC II-a
  • MYH9 variant protein
  • Myosin heavy chain 9
  • Myosin heavy chain, non-muscle IIa
  • myosin, heavy chain 9, non-muscle
  • myosin, heavy polypeptide 9, non-muscle
  • myosin-9
  • NMHC-II-A
  • NMMHCA
  • NMMHC-A
  • Non-muscle myosin heavy chain A
  • Non-muscle myosin heavy chain IIa
  • nonmuscle myosin heavy chain II-A
  • non-muscle myosin heavy polypeptide 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89033
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-65675
Species: Hu, Rt, Rb
Applications: ELISA, ICC/IF, IHC, IHC-P
NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-38986
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
H00000081-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-38566
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32463
Species: Hu
Applications: IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33570
Species: Hu
Applications: IHC, IHC-P
AF3159
Species: Mu
Applications: WB, IHC
MAB5175
Species: Mu
Applications: WB, IHC

Publications for non-muscle Myosin IIA Antibody (NBP2-62644) (0)

There are no publications for non-muscle Myosin IIA Antibody (NBP2-62644).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for non-muscle Myosin IIA Antibody (NBP2-62644) (0)

There are no reviews for non-muscle Myosin IIA Antibody (NBP2-62644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for non-muscle Myosin IIA Antibody (NBP2-62644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for non-muscle Myosin IIA Antibody (NBP2-62644)

Discover related pathways, diseases and genes to non-muscle Myosin IIA Antibody (NBP2-62644). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for non-muscle Myosin IIA Antibody (NBP2-62644)

Discover more about diseases related to non-muscle Myosin IIA Antibody (NBP2-62644).
 

Pathways for non-muscle Myosin IIA Antibody (NBP2-62644)

View related products by pathway.

PTMs for non-muscle Myosin IIA Antibody (NBP2-62644)

Learn more about PTMs related to non-muscle Myosin IIA Antibody (NBP2-62644).
 

Research Areas for non-muscle Myosin IIA Antibody (NBP2-62644)

Find related products by research area.

Blogs on non-muscle Myosin IIA

There are no specific blogs for non-muscle Myosin IIA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our non-muscle Myosin IIA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH9