NOM1 Antibody

Images

 
Western Blot: NOM1 Antibody [NBP2-58765] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: NOM1 Antibody [NBP2-58765] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VSWDSVLSAEQTGRWWIVGSAWSGAPMIDNSHHTHLQKQLVGTVSSKILELARKQRMNTDIRRNIFCTIMTSEDFLDAFEKLLKLGLKDQQEREIIHVLMDCCLQEKTYNPFYAFLASKFCEYERRFQMTFQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOM1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NOM1 Recombinant Protein Antigen (NBP2-58765PEP)

Reactivity Notes

Mouse (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NOM1 Antibody

  • C7orf3
  • chromosome 7 open reading frame 3
  • FLJ16401
  • nucleolar MIF4G domain-containing protein 1
  • nucleolar protein with MIF4G domain 1
  • SGD1 homolog
  • SGD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24691
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83302
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24632
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-24529
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
DMP900
Species: Hu
Applications: ELISA
NBP2-76831
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-57968
Species: Hu
Applications: IHC, IHC-P
1845-SH/CF
Species: Hu
Applications: BA
NBP2-03547
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-80695
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32618
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-45384
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC, WB
D6050
Species: Hu
Applications: ELISA

Publications for NOM1 Antibody (NBP2-58765) (0)

There are no publications for NOM1 Antibody (NBP2-58765).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOM1 Antibody (NBP2-58765) (0)

There are no reviews for NOM1 Antibody (NBP2-58765). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOM1 Antibody (NBP2-58765) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOM1 Products

Array NBP2-58765

Bioinformatics Tool for NOM1 Antibody (NBP2-58765)

Discover related pathways, diseases and genes to NOM1 Antibody (NBP2-58765). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOM1 Antibody (NBP2-58765)

Discover more about diseases related to NOM1 Antibody (NBP2-58765).
 

Pathways for NOM1 Antibody (NBP2-58765)

View related products by pathway.

Blogs on NOM1

There are no specific blogs for NOM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOM1