NOD2 Recombinant Protein Antigen

Images

 
There are currently no images for NOD2 Recombinant Protein Antigen (NBP2-48752PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NOD2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NOD2.

Source: E. coli

Amino Acid Sequence: VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NOD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48752.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NOD2 Recombinant Protein Antigen

  • BLAU
  • CARD15caspase recruitment domain protein 15
  • caspase recruitment domain family, member 15
  • Caspase recruitment domain-containing protein 15
  • CDACUG
  • CLR16.3
  • IBD1NLR family, CARD domain containing 2
  • Inflammatory bowel disease protein 1
  • NLRC2
  • NOD-like receptor C2
  • nucleotide-binding oligomerization domain 2
  • nucleotide-binding oligomerization domain containing 2
  • nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 2
  • nucleotide-binding oligomerization domain-containing protein 2
  • PSORAS1NOD2B

Background

NOD2 (nucleotide-binding oligomerization domain containing 2) is a member of the apoptosis regulating protein family that includes caspase recruitment-domains, as well as Apaf-1 and NOD1. It contains two N-terminal CARDs, a nucleotide binding domain (NBD), and multiple C-terminal leucine-rich repeats (LRRs). NOD2 is expressed in monocytes (whereas NOD1 is expressed in multiple tissues). NOD2 plays a role in regulating NF-kappaB. It also acts as an intracellular receptor for bacterial lipopolysaccharides and contributes to inflammatory bowel disease (IBD) and Crohn's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1106
Species: Hu
Applications: IP, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
7268-CT
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
M6000B
Species: Mu
Applications: ELISA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
AF2009
Species: Hu
Applications: ICC, IHC
6507-IL/CF
Species: Hu
Applications: BA
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
MAB342
Species: Hu
Applications: AgAct, ICC, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB2772
Species: Hu, Pm
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC
NBP1-83790
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for NOD2 Recombinant Protein Antigen (NBP2-48752PEP) (0)

There are no publications for NOD2 Recombinant Protein Antigen (NBP2-48752PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOD2 Recombinant Protein Antigen (NBP2-48752PEP) (0)

There are no reviews for NOD2 Recombinant Protein Antigen (NBP2-48752PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NOD2 Recombinant Protein Antigen (NBP2-48752PEP). (Showing 1 - 1 of 1 FAQ).

  1. Can you suggest the best NOD2 antibody for detection of endogenous NOD2 in human fibroblasts?
    • For detecting endogenous NOD2 in human samples, I would recommend NB100-524. This antibody has been validated for use in WB, IHC-Paraffin and IP.

Additional NOD2 Products

Research Areas for NOD2 Recombinant Protein Antigen (NBP2-48752PEP)

Find related products by research area.

Blogs on NOD2.


  Read full blog post.

Transferrin and the blood brain barrier
Transferrin, an iron binding protein that facilitates iron uptake in cells, is an integral part of a mechanism that may introduce antibody therapies to the central nervous system. Currently, the brain’s ability to take in antibody therapies i...  Read full blog post.

MHC Class I and the Herpes Simplex Virus
MHC molecules (also known as major histocompatibility complex molecules) assist in the presentation of antigens to T cells in order to eradicate foreign pathogens.  These molecules are highly polymorphic, meaning that they exist in multiple varian...  Read full blog post.

Cluster of Differentiation 3 (CD3) (OKT3 clone) as a Marker of Immune Response Efficiency
Our immune system is a powerful defense mechanism against infection, however different variables can cause our immune response to work for or against us.  CD3 (cluster of differentiation 3) is one component of our immune signal response that is co...  Read full blog post.

NOD2 - inflammatory signaling and NFkB activation
Nucleotide-binding oligomerization domain-containing protein 2 (NOD2) is an intracellular pattern recognition receptor (PRR) that plays an important role in recognizing bacterial pathogens and initiating an immune response. As a PRR, NOD2 recogniz...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NOD2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NOD2