NNT Antibody

Images

 
Western Blot: NNT Antibody [NBP1-86512] - Analysis in human cell line RH-30.
Immunohistochemistry: NNT Antibody [NBP1-86512] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NNT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NNT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NNT Protein (NBP1-86512PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NNT Antibody

  • MGC126502
  • mitochondrial
  • nicotinamide nucleotide transhydrogenaseMGC126503
  • Pyridine nucleotide transhydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-52926
Species: Hu
Applications: WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NBP1-20194
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for NNT Antibody (NBP1-86512) (0)

There are no publications for NNT Antibody (NBP1-86512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NNT Antibody (NBP1-86512) (0)

There are no reviews for NNT Antibody (NBP1-86512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NNT Antibody (NBP1-86512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NNT Products

Bioinformatics Tool for NNT Antibody (NBP1-86512)

Discover related pathways, diseases and genes to NNT Antibody (NBP1-86512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NNT Antibody (NBP1-86512)

Discover more about diseases related to NNT Antibody (NBP1-86512).
 

Pathways for NNT Antibody (NBP1-86512)

View related products by pathway.

PTMs for NNT Antibody (NBP1-86512)

Learn more about PTMs related to NNT Antibody (NBP1-86512).

Blogs on NNT

There are no specific blogs for NNT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NNT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NNT