NME7 Antibody - BSA Free

Immunohistochemistry-Paraffin: NME7 Antibody [NBP1-83482] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in cortical cells.

Analysis in control (vector only transfected HEK293T lysate) and NME7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NME7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NME7 Antibody - BSA Free (NBP1-83482) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NME7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NME7 Protein (NBP1-83482PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NME7 Antibody - BSA Free

• EC 2.7.4.6
• FLJ37194
• MN23H7
• NDK 7
• NDP kinase 7
• nm23-H7
• non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
• nucleoside diphosphate kinase 7
• nucleoside-diphosphate kinase 7

Background

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NME7