NME7 Antibody

Images

 
Western Blot: NME7 Antibody [NBP1-83482] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: NME7 Antibody [NBP1-83482] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in cortical cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NME7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NME7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NME7 Protein (NBP1-83482PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NME7 Antibody

  • EC 2.7.4.6
  • FLJ37194
  • MN23H7
  • NDK 7
  • NDP kinase 7
  • nm23-H7
  • non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
  • nucleoside diphosphate kinase 7
  • nucleoside-diphosphate kinase 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-81587
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02487
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45679
Species: Hu
Applications: WB, IHC, IF
H00004831-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-87219
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-266
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
AF6270
Species: Hu
Applications: ICC
AF3158
Species: Mu
Applications: WB, ChIP, ICC
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89910
Species: Hu
Applications: IHC, IHC-P
NBP1-83482
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NME7 Antibody (NBP1-83482) (0)

There are no publications for NME7 Antibody (NBP1-83482).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NME7 Antibody (NBP1-83482) (0)

There are no reviews for NME7 Antibody (NBP1-83482). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NME7 Antibody (NBP1-83482) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NME7 Products

Bioinformatics Tool for NME7 Antibody (NBP1-83482)

Discover related pathways, diseases and genes to NME7 Antibody (NBP1-83482). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NME7 Antibody (NBP1-83482)

Discover more about diseases related to NME7 Antibody (NBP1-83482).
 

Pathways for NME7 Antibody (NBP1-83482)

View related products by pathway.

Research Areas for NME7 Antibody (NBP1-83482)

Find related products by research area.

Blogs on NME7

There are no specific blogs for NME7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NME7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NME7