NME5 Antibody

Images

 
Western Blot: NME5 Antibody [NBP1-92188] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: NME5 Antibody [NBP1-92188] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: NME5 Antibody [NBP1-92188] - Staining of human fallopian tube shows strong positivity in cilia of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NME5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Specificity
Specificity of human NME5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NME5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NME5 Protein (NBP1-92188PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NME5 Antibody

  • Inhibitor of p53-induced apoptosis-beta
  • IPIA-beta
  • NDK-H 5
  • NDP kinase homolog 5
  • NM23H5
  • nm23-H5
  • non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase)
  • nucleoside diphosphate kinase homolog 5
  • radial spoke 23 homolog
  • RSPH23
  • Testis-specific nm23 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF3014
Species: Hu
Applications: WB, IHC, Block
H00004831-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P
NBP1-83482
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-02487
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15199
Species: Hu, Eq
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-82549
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-20229
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, ICC
NBP2-33786
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88244
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NME5 Antibody (NBP1-92188) (0)

There are no publications for NME5 Antibody (NBP1-92188).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NME5 Antibody (NBP1-92188) (0)

There are no reviews for NME5 Antibody (NBP1-92188). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NME5 Antibody (NBP1-92188) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NME5 Antibody (NBP1-92188)

Discover related pathways, diseases and genes to NME5 Antibody (NBP1-92188). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NME5 Antibody (NBP1-92188)

Discover more about diseases related to NME5 Antibody (NBP1-92188).
 

Pathways for NME5 Antibody (NBP1-92188)

View related products by pathway.

PTMs for NME5 Antibody (NBP1-92188)

Learn more about PTMs related to NME5 Antibody (NBP1-92188).
 

Research Areas for NME5 Antibody (NBP1-92188)

Find related products by research area.

Blogs on NME5

There are no specific blogs for NME5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NME5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NME5