NME5 Antibody - BSA Free

Immunohistochemistry-Paraffin: NME5 Antibody [NBP1-92188] - Staining of human lung shows weak cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: NME5 Antibody [NBP1-92188] - Staining of human fallopian tube shows strong positivity in cilia of glandular cells.

Immunohistochemistry-Paraffin: NME5 Antibody [NBP1-92188] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: NME5 Antibody [NBP1-92188] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NME5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NME5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NME5 Protein (NBP1-92188PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NME5 Antibody - BSA Free

• Inhibitor of p53-induced apoptosis-beta
• IPIA-beta
• NDK-H 5
• NDP kinase homolog 5
• NM23H5
• nm23-H5
• non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase)
• nucleoside diphosphate kinase homolog 5
• radial spoke 23 homolog
• RSPH23
• Testis-specific nm23 homolog

Background

NME5, or Nucleoside diphosphate kinase homolog 5, consists of a 212 amino acid isoform that is 24 kDa, and is involved in spermiogenesis. Current disease research is being conducted on the relationship between NME5 and pneumonia. The protein has been linked to several biological processes, including purine metabolism, pyrimidine metabolism, and the pyrimidine ribonucleotide salvage pathway. NME5 has been found to interact with DYDC1, DYDC2, RELA, NFS1, and AK7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NME5