PKD1L1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PKD1L1 Antibody [NBP1-87219] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli, cytoplasm and golgi apparatus.
Immunohistochemistry-Paraffin: PKD1L1 Antibody [NBP1-87219] - Staining of human gall bladder shows distinct membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKD1L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HGLEAHTVFSVFCMSGKPDFHYEFSYQIGNTSKHTLYHGRDTQYYFVLPAGEHLDNYKVMVSTEITDGEGSKVQQCTVVVTVLPRYHGNDCLGEDLYNSSLKNLSTLQLMGSYTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PKD1L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PKD1L1 Protein (NBP1-87219PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PKD1L1 Antibody

  • PC1-like 1 protein
  • polycystic kidney disease 1 like 1
  • polycystic kidney disease protein 1-like 1
  • polycystin-1L1
  • PRO19563

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6270
Species: Hu
Applications: ICC
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45679
Species: Hu
Applications: WB, IHC, IF
NBP2-37619
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005352-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NLS418
Species: Hu
Applications: IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-81665
Species: Hu, Mu
Applications: WB (-), IHC-P, IP
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
NBP1-83482
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PKD1L1 Antibody (NBP1-87219) (0)

There are no publications for PKD1L1 Antibody (NBP1-87219).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKD1L1 Antibody (NBP1-87219) (0)

There are no reviews for PKD1L1 Antibody (NBP1-87219). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PKD1L1 Antibody (NBP1-87219) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKD1L1 Products

Bioinformatics Tool for PKD1L1 Antibody (NBP1-87219)

Discover related pathways, diseases and genes to PKD1L1 Antibody (NBP1-87219). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKD1L1 Antibody (NBP1-87219)

Discover more about diseases related to PKD1L1 Antibody (NBP1-87219).
 

Pathways for PKD1L1 Antibody (NBP1-87219)

View related products by pathway.

Blogs on PKD1L1

There are no specific blogs for PKD1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKD1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PKD1L1