![Western Blot: NM23-H2/NME2 Antibody [NBP3-05624] - Analysis of extracts of various cell lines, using NME2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/NM23-H2-NME2-Antibody-Western-Blot-NBP3-05624-img0001.jpg "Western Blot: NM23-H2/NME2 Antibody [NBP3-05624] - Analysis of extracts of various cell lines, using NME2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human NM23-H2/NME2 (NP_001018148.1). MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NME2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Publication using NBP3-05624 | Applications | Species |
|---|---|---|
| Burda JE, O'Shea TM, Ao Y et al. Divergent transcriptional regulation of astrocyte reactivity across disorders Nature May 25 2022 [PMID: 35614216] (IHC-Fr, Mouse) | IHC-Fr | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for NM23-H2/NME2 Antibody (NBP3-05624)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NME2 |
![Immunohistochemistry-Paraffin: NM23-H2/NME2 Antibody [NBP3-05624] - Mouse kidney using NME2 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/NM23-H2-NME2-Antibody-Immunohistochemistry-Paraffin-NBP3-05624-img0003.jpg "Immunohistochemistry-Paraffin: NM23-H2/NME2 Antibody [NBP3-05624] - Mouse kidney using NME2 antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: NM23-H2/NME2 Antibody [NBP3-05624] - Human kidney using NME2 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/NM23-H2-NME2-Antibody-Immunohistochemistry-Paraffin-NBP3-05624-img0002.jpg "Immunohistochemistry-Paraffin: NM23-H2/NME2 Antibody [NBP3-05624] - Human kidney using NME2 antibody at dilution of 1:100 (40x lens).")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Bioactivity KGF/FGF-7 [Unconjugated]](https://images.novusbio.com/images2/KGF_251KG_2860.jpg)
![Bioactivity KGF/FGF-7 [Unconjugated]](https://images.novusbio.com/images/251-kg_recombinant-human-kgf-fgf-7-protein-bioactivity-2520239811.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")