NM23-H1 Antibody (1D7)

Images

 
Western Blot: NM23-H1 Antibody (1D7) [H00004830-M02] - NME1 monoclonal antibody (M02), clone 1D7. Analysis of NME1 expression in different cell lines.
Immunocytochemistry/ Immunofluorescence: NM23-H1 Antibody (1D7) [H00004830-M02] - Analysis of monoclonal antibody to NME1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: NM23-H1 Antibody (1D7) [H00004830-M02] - Analysis of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Western Blot: NM23-H1 Antibody (1D7) [H00004830-M02] - NME1 monoclonal antibody (M02), clone 1D7. Analysis of NME1 expression in HeLa.
Western Blot: NM23-H1 Antibody (1D7) [H00004830-M02] - Analysis of NME1 expression in transfected 293T cell line by NME1 monoclonal antibody (M02), clone 1D7.Lane 1: NME1 transfected lysate(19.7 KDa).Lane 2: ...read more
Immunoprecipitation: NM23-H1 Antibody (1D7) [H00004830-M02] - Analysis of NME1 transfected lysate using anti-NME1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NME1 MaxPab rabbit polyclonal ...read more
ELISA: NM23-H1 Antibody (1D7) [H00004830-M02] - Detection limit for recombinant GST tagged NME1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, IP
Clone
1D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NM23-H1 Antibody (1D7) Summary

Immunogen
NME1 (NP_000260, 43 a.a. - 152 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Specificity
NME1 - non-metastatic cells 1, protein (NM23A) expressed in
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NME1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Positive Control
NM23-H1 Lysate (NBP2-65588)
Publications
Read Publications using
H00004830-M02 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NM23-H1 Antibody (1D7)

  • EC 2.7.4.6
  • GAAD
  • Granzyme A-activated DNase
  • Metastasis inhibition factor nm23
  • NB
  • NBS
  • NDK A
  • NDKA
  • NDP kinase A
  • NDPKA
  • NDPK-A
  • NM23A
  • NM23AWD
  • NM23H1
  • NM23-H1
  • NME1
  • non-metastatic cells 1, protein (NM23A) expressed in
  • nucleoside diphosphate kinase A
  • Tumor metastatic process-associated protein

Background

This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004831-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF3014
Species: Hu
Applications: WB, IHC, Block
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
AF2009
Species: Hu
Applications: WB, IHC
NBP2-67605
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-32244
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for NM23-H1 Antibody (H00004830-M02)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NM23-H1 Antibody (H00004830-M02) (0)

There are no reviews for NM23-H1 Antibody (H00004830-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NM23-H1 Antibody (H00004830-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NM23-H1 Antibody (H00004830-M02)

Discover related pathways, diseases and genes to NM23-H1 Antibody (H00004830-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NM23-H1 Antibody (H00004830-M02)

Discover more about diseases related to NM23-H1 Antibody (H00004830-M02).
 

Pathways for NM23-H1 Antibody (H00004830-M02)

View related products by pathway.

PTMs for NM23-H1 Antibody (H00004830-M02)

Learn more about PTMs related to NM23-H1 Antibody (H00004830-M02).

Blogs on NM23-H1

There are no specific blogs for NM23-H1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NM23-H1 Antibody (1D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol NME1
Entrez
Uniprot