NLRX1 Antibody - BSA Free

Western Blot: NLRX1 Antibody [NBP2-87928] - Sample Type: Lane 1: 35ug mouse neuroblastoma cells w/ empty vector Lane 2: 35ug mouse neuroblastoma cells w/ NLRX1 siRNA Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:1000 Color/Signal Descriptions

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NLRX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NLRX1 Antibody - BSA Free (NBP2-87928) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NLRX1. Peptide sequence: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NLRX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NLRX1 Antibody - BSA Free

• Caterpiller protein 11.3
• CLR11.3DLNB26
• MGC131937
• MGC21025
• NLR family member X1
• NLR family, X1
• NOD26
• NOD5
• NOD9FLJ21478
• NOD-like receptor X1
• Nucleotide-binding oligomerization domain protein 26
• Nucleotide-binding oligomerization domain protein 5
• Nucleotide-binding oligomerization domain protein 9
• nucleotide-binding oligomerization domain, leucine rich repeat containing X1

Background

NLRX1 encodes a member of the NLR family. Alternative splicing has been observed at this gene locus and two transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NLRX1