NLRP2/NALP2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit NLRP2/NALP2 Antibody - BSA Free (NBP1-85553) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NLRP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 0.04-0.4 ug/ml
|
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NLRP2/NALP2 Antibody - BSA Free
Background
NLRP2/NALP2, aka PAN1 and PYPAF2, belongs to a cytoplasmic proteins family containing a NACHT domain, leucine rich repeat (NLR) and N-terminal pyrin-containing domain (PYD). As an intracellular pathogen-recognition receptors (PRRs), NLRP2/NALP2 is a 1062 amino acid protein associated in cell responses to apoptotic and inflammatory stimuli. PRRs are key components of immune systems involving in an innate effector mechanisms and activation of adaptive immunity. By interacting with ASC in addition to CARD8 and caspase 1, NLRP2/NALP2 forms an inflammasome functioning as a modulator of NF-kB and procaspase-1 activation in macrophages. Similar to TLRs, activation of the inflammasome by NLRs occurs through the recognition of pathogen-associated molecular patterns (PAMPs) through their LRR domains. NLRP2/NALP2 expressions varies in several human tumor cell lines though the highest were found in MDA-MB-435 and MCF-7 breast cancer, UACC62 melanoma, and Caco2 colon cancer cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP
Species: Hu
Applications: IHC, WB
Publications for NLRP2/NALP2 Antibody (NBP1-85553) (0)
There are no publications for NLRP2/NALP2 Antibody (NBP1-85553).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NLRP2/NALP2 Antibody (NBP1-85553) (0)
There are no reviews for NLRP2/NALP2 Antibody (NBP1-85553).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NLRP2/NALP2 Antibody (NBP1-85553) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NLRP2/NALP2 Products
Research Areas for NLRP2/NALP2 Antibody (NBP1-85553)
Find related products by research area.
|
Blogs on NLRP2/NALP2