NLRP10/Pynod/NALP10 Recombinant Protein Antigen

Images

 
There are currently no images for NLRP10/Pynod/NALP10 Protein (NBP1-85557PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NLRP10/Pynod/NALP10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NLRP10.

Source: E. coli

Amino Acid Sequence: RLLEVKEQEGNDEMTLTMQFLLDISKKDSFSNLELKFCFRISPCLAQDLKHFKEQMESMKHNRTWDLEFSLYEAKIKNLVKGIQMNNVSFKIKHSNEKKSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NLRP10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85557.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NLRP10/Pynod/NALP10 Recombinant Protein Antigen

  • CLR11.1
  • NACHT, leucine rich repeat and PYD containing 10
  • NALP10
  • NALP10Pynod
  • NLR family, pyrin domain containing 10
  • NLRP10
  • NOD8
  • NOD8Nucleotide-binding oligomerization domain protein 8
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 10
  • PAN5
  • Pynod
  • PYNODNACHT, LRR and PYD domains-containing protein 10

Background

Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminalleucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). The protein encoded by this gene belongs tothe NALP protein family despite lacking the LRR region. This protein likely plays a regulatory role in the innateimmune system. The protein belongs to the signal-induced multiprotein complex, the inflammasome, that activates thepro-inflammatory caspases, caspase-1 and caspase-5. Other experiments indicate that this gene acts as amultifunctional negative regulator of inflammation and apoptosis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB868
Species: Hu
Applications: WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
NB100-56155
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-54899
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NB100-781
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
NBP1-76293
Species: Hu, Mu, Rt, V-Vi
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP3-12306
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP1-85557PEP
Species: Hu
Applications: AC

Publications for NLRP10/Pynod/NALP10 Protein (NBP1-85557PEP) (0)

There are no publications for NLRP10/Pynod/NALP10 Protein (NBP1-85557PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRP10/Pynod/NALP10 Protein (NBP1-85557PEP) (0)

There are no reviews for NLRP10/Pynod/NALP10 Protein (NBP1-85557PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NLRP10/Pynod/NALP10 Protein (NBP1-85557PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NLRP10/Pynod/NALP10 Products

Blogs on NLRP10/Pynod/NALP10

There are no specific blogs for NLRP10/Pynod/NALP10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NLRP10/Pynod/NALP10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP10