NKX2.2 Recombinant Protein Antigen

Images

 
There are currently no images for NKX2.2 Protein (NBP1-82554PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NKX2.2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NKX2 - 2.

Source: E. coli

Amino Acid Sequence: SLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NKX2-2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82554.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NKX2.2 Recombinant Protein Antigen

  • Homeobox protein NK-2 homolog B
  • NK-2 (Drosophila) homolog B
  • NK2 homeobox 2
  • NK2 transcription factor related, locus 2 (Drosophila)
  • NK2 transcription factor related, locus 2
  • NK2 transcription factor-like protein B
  • NKX2.2
  • NKX2.2homeobox protein Nkx-2.2
  • NKX2B
  • NKX2BNK-2 homolog B

Background

Nkx2.2, or Homeobox protein Nkx-2.2, consists of a 273 amino acid isoform that is 30 kDa, and is involved in controlling and maintaining the expression of genes within pancreatic endocrine cells and axons. Current research is being conducted on the relationship between Nkx2.2 and a variety of diseases and disorders, including glioma, neuronitis, maturity-onset diabetes, pancreatitis, Partington syndrome, sarcoma, gastrointestinal neuroendocrine tumor, acute lymphoblastic leukemia, multiple sclerosis, and carcinoid tumors. The protein has been linked to the Wnt, Hedgehog, and notch pathways, as well as regulation of beta-cell development and gene expression. NKx2.2 interacts with several other proteins, including OLIG2, HDAC1, SIN3A, FOXA2, and FOXO1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3444
Species: Hu
Applications: IHC, WB
NBP1-49672
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF2419
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
AF2418
Species: Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ICC, IHC, WB
AF2746
Species: Hu, Mu
Applications: ICC, WB
AF1837
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF2614
Species: Hu
Applications: ICC, WB
NBP1-84079
Species: Hu
Applications: IHC,  IHC-P, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
AF2567
Species: Mu
Applications: IHC, WB
MAB2358
Species: Hu, Mu
Applications: ICC, IHC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
NBP2-22218
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB2417
Species: Hu
Applications: IHC, WB
AF2864
Species: Hu
Applications: ICC, IHC, WB

Publications for NKX2.2 Protein (NBP1-82554PEP) (0)

There are no publications for NKX2.2 Protein (NBP1-82554PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKX2.2 Protein (NBP1-82554PEP) (0)

There are no reviews for NKX2.2 Protein (NBP1-82554PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NKX2.2 Protein (NBP1-82554PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NKX2.2 Products

Blogs on NKX2.2

There are no specific blogs for NKX2.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NKX2.2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NKX2-2