NKRF Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 391-690 of human NKRF (NP_060014.2). YGTKKTSKHAAADEALKILQKTQPTYPSVKSSQCHTGSSPRGSGKKKDIKDLVVYENSSNPVCTLNDTAQFNRMTVEYVYERMTGLRWKCKVILESEVIAEAVGVKKTVKYEAAGEAVKTLKKTQPTVINNLKKGAVEDVISRNEIQGRSAEEAYKQQIKEDNIGNQLLRKMGWTGGGLGKSGEGIREPISVKEQHKREGLGLDVERVNKIAKRDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMPQAN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NKRF |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NKRF Antibody - BSA Free
Background
The NKRF gene encodes a transcription factor that interacts with specific negative regulatory elements (NREs) to mediatetranscriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to thenucleolus with a small fractio
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for NKRF Antibody (NBP2-94323) (0)
There are no publications for NKRF Antibody (NBP2-94323).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NKRF Antibody (NBP2-94323) (0)
There are no reviews for NKRF Antibody (NBP2-94323).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NKRF Antibody (NBP2-94323) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NKRF Products
Research Areas for NKRF Antibody (NBP2-94323)
Find related products by research area.
|
Blogs on NKRF