NINL Antibody

Images

 
Immunohistochemistry: NINL Antibody [NBP1-81451] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

NINL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NINL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NINL Protein (NBP1-81451PEP)
Publications
Read Publication using NBP1-81451.

Alternate Names for NINL Antibody

  • ninein-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-47356
Species: Hu
Applications: IHC, IHC-P
NB100-56651
Species: Hu, Mu, Rt, Po, Bv, Ca, Pm
Applications: WB, IHC-P
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57253
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, IHC-FrFl
NBP1-61243
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
AF888
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-02575
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-41185
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for NINL Antibody (NBP1-81451)(1)

Reviews for NINL Antibody (NBP1-81451) (0)

There are no reviews for NINL Antibody (NBP1-81451). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NINL Antibody (NBP1-81451) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NINL Antibody Products

Related Products by Gene

Bioinformatics Tool for NINL Antibody (NBP1-81451)

Discover related pathways, diseases and genes to NINL Antibody (NBP1-81451). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NINL Antibody (NBP1-81451)

Discover more about diseases related to NINL Antibody (NBP1-81451).

Blogs on NINL

There are no specific blogs for NINL, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol NINL
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81451 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought