NINL Antibody (NBP1-81451)

Images

 
Immunocytochemistry/ Immunofluorescence: NINL Antibody [NBP1-81451] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & cytokinetic bridge.
Immunohistochemistry-Paraffin: NINL Antibody [NBP1-81451] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NINL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NINL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NINL Protein (NBP1-81451PEP)
Publications
Read Publication using NBP1-81451.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NINL Antibody

  • ninein-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-47356
Species: Hu
Applications: IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02575
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for NINL Antibody (NBP1-81451)(1)

Reviews for NINL Antibody (NBP1-81451) (0)

There are no reviews for NINL Antibody (NBP1-81451). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NINL Antibody (NBP1-81451) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NINL Products

Related Products by Gene

Bioinformatics Tool for NINL Antibody (NBP1-81451)

Discover related pathways, diseases and genes to NINL Antibody (NBP1-81451). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NINL Antibody (NBP1-81451)

Discover more about diseases related to NINL Antibody (NBP1-81451).

Blogs on NINL

There are no specific blogs for NINL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NINL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NINL
Entrez
Uniprot