Niemann-Pick type C1 Like-1 Antibody - BSA Free

Western Blot: Niemann-Pick type C1 Like-1 Antibody [NBP2-86732] - Host: Rabbit. Target Name: NPCL1. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Niemann-Pick type C1 Like-1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human Niemann-Pick type C1 Like-1. Peptide sequence: YGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGVA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPC1L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Niemann-Pick type C1 Like-1 Antibody - BSA Free

• Niemann-Pick C1-like protein 1
• NPC1 (Niemann-Pick disease, type C1, gene)-like 1
• NPC11L1

Background

Dietary consumption and intestinal cholesterol absorption contribute to plasma cholesterol levels, which factor into the risk of coronary heart disease. Niemann-Pick type C1 Like 1 protein (NPC1L1 or NPC3) is enriched in the small intestine and is found in the brush border membrane of enterocytes. It plays a critical role in absorption of intestinal cholesterol.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPC1L1