Niban Antibody

Images

 
Immunohistochemistry: Niban Antibody [NBP1-88340] - Staining of human pancreas shows strong cytoplasmic and membrane positivity in exocrine cells while islet cells were negative.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Niban Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VESYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKENTQPFVVLPKEFPVYLWQPFFRHGYFCFHEAADQKRFSALLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM129A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Niban Protein (NBP1-88340PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Niban Antibody

  • C1orf24
  • cell growth inhibiting protein 39
  • Cell growth-inhibiting gene 39 protein
  • chromosome 1 open reading frame 24
  • family with sequence similarity 129, member A
  • GIG39
  • NIBANFLJ38228
  • Protein FAM129A
  • protein Niban

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-46539
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
AF6696
Species: Hu, Mu, Rt
Applications: WB, ICC
AF482
Species: Mu
Applications: WB, IHC
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Niban Antibody (NBP1-88340) (0)

There are no publications for Niban Antibody (NBP1-88340).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Niban Antibody (NBP1-88340) (0)

There are no reviews for Niban Antibody (NBP1-88340). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Niban Antibody (NBP1-88340) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Niban Products

Bioinformatics Tool for Niban Antibody (NBP1-88340)

Discover related pathways, diseases and genes to Niban Antibody (NBP1-88340). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Niban Antibody (NBP1-88340)

Discover more about diseases related to Niban Antibody (NBP1-88340).
 

Pathways for Niban Antibody (NBP1-88340)

View related products by pathway.

PTMs for Niban Antibody (NBP1-88340)

Learn more about PTMs related to Niban Antibody (NBP1-88340).

Blogs on Niban

There are no specific blogs for Niban, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Niban Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM129A