NHE8 Antibody - BSA Free

Western Blot: NHE8 Antibody [NBP1-59888] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NHE8 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC9A8(solute carrier family 9 (sodium/hydrogen exchanger), member 8) The peptide sequence was selected from the middle region of SLC9A8. Peptide sequence AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC9A8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25377912).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NHE8 Antibody - BSA Free

• DKFZp686C03237
• KIAA0939
• KIAA0939DKFZp686C03237
• MGC138418
• Na(+)/H(+) exchanger 8
• NHE8
• NHE-8
• NHE8FLJ42500
• SLC9A8
• sodium/hydrogen exchanger 8
• solute carrier family 9 (sodium/hydrogen exchanger)
• solute carrier family 9 (sodium/hydrogen exchanger), isoform 8
• solute carrier family 9 (sodium/hydrogen exchanger), member 8
• Solute carrier family 9 member 8

Background

Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NHE8 Antibody (NBP1-59888)(2)

Publications using NBP1-59888

• Wiebe SA, Plain A, Pan W et al. NHE8 attenuates calcium influx into NRK cells and the proximal tubule epithelium Am. J. Physiol. Renal Physiol. 2019-05-01 [PMID: 31042050]
• Pirojsakul K, Gattineni J, Dwarakanath V, Baum M. Renal nHE Expression and Activity in neonatal nHE3 and nHE8 null Mice Am. J. Physiol. Renal Physiol. 2014-11-05 [PMID: 25377912] (WB, Mouse)
  
  Details:
  nHE8 antibody used for WB on lysates of neonatal control and nHE3-/- Mice treated or not with acid (Figure 2, Figure 6) - primary antibody used at 1:1000 dilution with 4C On incubation.

Bioinformatics

• Gene Symbol: SLC9A8
• Uniprot:
  • Q2M1U9(Human)