NHE8 Antibody


Western Blot: NHE8 Antibody [NBP1-59888] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

NHE8 Antibody Summary

Synthetic peptides corresponding to SLC9A8(solute carrier family 9 (sodium/hydrogen exchanger), member 8) The peptide sequence was selected from the middle region of SLC9A8. Peptide sequence AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQE
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC9A8 and was validated on Western blot.
Read Publication using
NBP1-59888 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NHE8 Antibody

  • DKFZp686C03237
  • KIAA0939DKFZp686C03237
  • MGC138418
  • Na(+)/H(+) exchanger 8
  • NHE-8
  • NHE8FLJ42500
  • sodium/hydrogen exchanger 8
  • solute carrier family 9 (sodium/hydrogen exchanger)
  • solute carrier family 9 (sodium/hydrogen exchanger), isoform 8
  • solute carrier family 9 (sodium/hydrogen exchanger), member 8
  • Solute carrier family 9 member 8


Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB

Publications for NHE8 Antibody (NBP1-59888)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for NHE8 Antibody (NBP1-59888) (0)

There are no reviews for NHE8 Antibody (NBP1-59888). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHE8 Antibody (NBP1-59888) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NHE8 Products

Bioinformatics Tool for NHE8 Antibody (NBP1-59888)

Discover related pathways, diseases and genes to NHE8 Antibody (NBP1-59888). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHE8 Antibody (NBP1-59888)

Discover more about diseases related to NHE8 Antibody (NBP1-59888).

Pathways for NHE8 Antibody (NBP1-59888)

View related products by pathway.

PTMs for NHE8 Antibody (NBP1-59888)

Learn more about PTMs related to NHE8 Antibody (NBP1-59888).

Research Areas for NHE8 Antibody (NBP1-59888)

Find related products by research area.

Blogs on NHE8

There are no specific blogs for NHE8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NHE8 Antibody and receive a gift card or discount.


Gene Symbol SLC9A8