SLC9A2 Antibody

Images

 
Western Blot: SLC9A2 Antibody [NBP2-38236] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: SLC9A2 Antibody [NBP2-38236] - Staining of human stomach shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC9A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLRESIRKDSSLNREHRASTSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKS
Specificity
Specificity of human SLC9A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC9A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC9A2 Protein (NBP2-38236PEP)
Publications
Read Publication using
NBP2-38236 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC9A2 Antibody

  • solute carrier family 9 (sodium/hydrogen exchanger)
  • solute carrier family 9 (sodium/hydrogen exchanger), member 2
  • solute carrier family 9 member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-81529
Species: Hu, Mu, Rt, Po, Ma-Op, Pm, Rb
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IP, KD, KO
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38280
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-62091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP1-84450
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IHC-WhMt
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
DPSG10
Species: Hu
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-80996
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4256
Species: Hu
Applications: WB
H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-90225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP

Publications for SLC9A2 Antibody (NBP2-38236)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SLC9A2 Antibody (NBP2-38236) (0)

There are no reviews for SLC9A2 Antibody (NBP2-38236). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC9A2 Antibody (NBP2-38236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC9A2 Products

Bioinformatics Tool for SLC9A2 Antibody (NBP2-38236)

Discover related pathways, diseases and genes to SLC9A2 Antibody (NBP2-38236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC9A2 Antibody (NBP2-38236)

Discover more about diseases related to SLC9A2 Antibody (NBP2-38236).
 

Pathways for SLC9A2 Antibody (NBP2-38236)

View related products by pathway.

PTMs for SLC9A2 Antibody (NBP2-38236)

Learn more about PTMs related to SLC9A2 Antibody (NBP2-38236).

Blogs on SLC9A2

There are no specific blogs for SLC9A2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC9A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A2
Uniprot