NHE3/SLC9A3 Antibody - BSA Free

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human cerebral cortex, colon, gallbladder and lymph node using Anti-SLC9A3 antibody NBP1-82575 (A) shows similar protein distribution across tissues to independent antibody NBP1-82574 (B).

Immunocytochemistry/Immunofluorescence: NHE3/SLC9A3 Antibody [NBP1-82575] - Immunofluorescence micrograph of human intestine showing polarized distribution of apical (NHE3) protein. ICC/IF image submitted by a verified customer review.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human liver shows no membranous positivity in hepatocytes as expected.

Immunocytochemistry/Immunofluorescence: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Analysis in human colon and liver tissues using NBP1-82575 antibody. Corresponding SLC9A3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human colon shows strong positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human kidney shows moderate positivity in apical membrane in cells in tubules.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82575] - Staining of human small intestine shows moderate positivity in apical membrane in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NHE3/SLC9A3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NHE3/SLC9A3 Antibody - BSA Free (NBP1-82575) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-NHE3/SLC9A3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQSLEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTM
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC9A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NHE3/SLC9A3 Protein (NBP1-82575PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NHE3/SLC9A3 Antibody - BSA Free

• isoform 3
• MGC126718
• NHE3
• NHE3MGC126720
• SLC9A3
• solute carrier family 9 (sodium/hydrogen exchanger), member 3
• Solute carrier family 9 member 3

Background

NHE3 is a member of the Sodium/Hydrogen exchanger family that plays a crucial role in acid-base and volume homeostasis by mediating the majority of sodium and bicarbonate reabsorption in the proximal tubule of the kidney. Two PKA consensus sites have been discovered in rat NHE3, serine 552 and serine 605. Research suggests that dopamine-induced phosphorylation of these consensus sites inhibit NHE3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NHE3/SLC9A3 Antibody (NBP1-82575)(1)

Publication using NBP1-82575

• Kasendra M, Tovaglieri A, Sontheimer-Phelps A, et al. Kasendra M, Tovaglieri A, Sontheimer-Phelps A, et al. Sci Rep. 2018-02-13 [PMID: 29440725] (ICC/IF, Human)

Review for NHE3/SLC9A3 Antibody (NBP1-82575) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human and Human small intestine.

reviewed by: Sasan Jalili ICC Human and Human small intestine 03/25/2020

Summary

• Application: Immunocytochemistry
• Sample Tested: Small intestine
• Species: Human and Human small intestine
• Lot: N/A

FAQs for NHE3/SLC9A3 Antibody (NBP1-82575). (Showing 1 - 1 of 1 FAQ).

1. The molecular weight of NHE3 is 92kDa but I see a band above 100 kDa.  I am confused, because the size of these protein should not be greater than 100KD. Can you please help explain?  
   • Higher than predicted molecular weight seen on WB is not uncommon if the protein is posttranslationally modified, especially glycosylated, and such is the case for NHE3. Please note that NHE3 gets phosphorylated and glycosylated (Uniprot ID P48764) and potentially, these modifications are adding ~10kDa extra to the predicted molecular weight. If you want to confirm it 100%, you could try de-glycosylating your protein and then performing a WB on it. 

Bioinformatics

• Gene Symbol: SLC9A3