NFkB p100/p52 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87759] - Staining in human appendix and skeletal muscle tissues using anti-NFKB2 antibody. Corresponding NFKB2 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87759] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NFKB2 antibody NBP1-87759 (A) shows similar ...read more
Orthogonal Strategies: Western Blot: NFkB p100/p52 Antibody [NBP1-87759] - Western blot analysis in human cell lines A-431 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading ...read more
Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87759] - Staining of human kidney.
Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87759] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87759] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87759] - Staining of human lymph node.
Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87759] - Staining of human testis.
Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87759] - Staining of human cerebral cortex using Anti-NFKB2 antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NFkB p100/p52 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQP
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFKB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NFkB p100/p52 Protein (NBP1-87759PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NFkB p100/p52 Antibody

  • DNA-binding factor KBF2
  • H2TF1
  • Lymphocyte translocation chromosome 10 protein
  • Lyt10
  • LYT10LYT-10
  • nuclear factor NF-kappa-B p100 subunit
  • nuclear factor of kappa light chain gene enhancer in B-cells 2
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
  • Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
  • Oncogene Lyt-10
  • p52

Background

The NFkappaB transcription factor was originally identified as a protein complex consisting of a DNA binding subunit and an associated protein. The DNA binding subunit is functionally related to c-Rel p75 and Rel B p68. The p50 subunit was initially believed to be a functionally unique protein derived from the amino-terminus of a precursor designated p105. A cDNA has been isolated that encodes an alternative DNA binding subunit of NFkappaB. It is synthesized as a protein that is expressed in a variety of cell types and, like p105, undergoes cleavage to generate its NFkappaB subunit, in this case a protein designated p52 (previously referred to as p49). In contrast to p50 derived from p105, p52 acts in synergy with p65 to stimulate the HIV enhancer in transiently transfected Jurkat cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NFkB p100/p52 Antibody (NBP1-87759) (0)

There are no publications for NFkB p100/p52 Antibody (NBP1-87759).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFkB p100/p52 Antibody (NBP1-87759) (0)

There are no reviews for NFkB p100/p52 Antibody (NBP1-87759). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NFkB p100/p52 Antibody (NBP1-87759) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFkB p100/p52 Products

Research Areas for NFkB p100/p52 Antibody (NBP1-87759)

Find related products by research area.

Blogs on NFkB p100/p52.

Nuclear Factor kappa B Signaling in the Immune System
Nuclear Factor kappa B (NFkB) binds to the kappa-beta site of the immunoglobulin kappa light chain gene enhancer. Thus NFkB has become one of the widely studied transcription factors in innate and adaptive immune responses. The NFkB family is composed...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFkB p100/p52 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFKB2