Neurotensin Antibody

Images

 
Western Blot: Neurotensin Antibody [H00004922-B01P] - Analysis of NTS expression in transfected 293T cell line by NTS polyclonal antibody. Lane 1: NTS transfected lysate(18.7 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Neurotensin Antibody Summary

Immunogen
NTS (NP_006174.1, 1 a.a. - 170 a.a.) full-length human protein. MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NTS
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Neurotensin Antibody

  • neurotensin
  • neurotensin/neuromedin N
  • NMN-125
  • NN
  • NT
  • NT/N
  • NTS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
DY7847-05
Species: Hu
Applications: ELISA
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-94348
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
MAB4077
Species: Hu
Applications: IHC, WB
H00002520-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
H00004922-B01P
Species: Hu
Applications: WB

Publications for Neurotensin Antibody (H00004922-B01P) (0)

There are no publications for Neurotensin Antibody (H00004922-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurotensin Antibody (H00004922-B01P) (0)

There are no reviews for Neurotensin Antibody (H00004922-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neurotensin Antibody (H00004922-B01P). (Showing 1 - 1 of 1 FAQ).

  1. Can you please send me the amino acid sequences of the immunogens used for generating your 7 different Neurotensin antibodies (H00004922-M03, H00004922-M01, H00004922-B01, H0000-B01P, H00004922-D01P, NBP1-50153, and NBP178333).
    • The immunogen of H00004922-M01 and H00004922-M03 is amino acids 71-171 of the NTS protein (accession number is AAH10918). As for H00004922-B01, H00004922-B01P and H00004922-D01P, their immunogen is full-length human NTS protein (accession number NP_006174.1) To our knowledge these antibodies have not been epitope mapped.

Secondary Antibodies

 

Isotype Controls

Additional Neurotensin Products

Bioinformatics Tool for Neurotensin Antibody (H00004922-B01P)

Discover related pathways, diseases and genes to Neurotensin Antibody (H00004922-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurotensin Antibody (H00004922-B01P)

Discover more about diseases related to Neurotensin Antibody (H00004922-B01P).
 

Pathways for Neurotensin Antibody (H00004922-B01P)

View related products by pathway.

PTMs for Neurotensin Antibody (H00004922-B01P)

Learn more about PTMs related to Neurotensin Antibody (H00004922-B01P).
 

Research Areas for Neurotensin Antibody (H00004922-B01P)

Find related products by research area.

Blogs on Neurotensin

There are no specific blogs for Neurotensin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neurotensin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NTS
Uniprot