We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Neuropeptide Y Antibody (904032) [DyLight 650]

Images

 
There are currently no images for Neuropeptide Y Antibody (FAB8517W).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Applications IHC
Clone
904032
Clonality
Monoclonal
Host
Mouse
Conjugate
DyLight 650

Order Details

Neuropeptide Y Antibody (904032) [DyLight 650] Summary

Description
This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
Immunogen
Neuropeptide Y/NPY conjugated to KLH
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Accession # P01303
Specificity
Detects human Neuropeptide Y/NPY in direct ELISAs.
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
NPY
Purity
Protein A or G purified from hybridoma culture supernatant
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
Application Notes
Recommended applications are based on validated applications from the unconjugated base product MAB8517. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A or G purified from hybridoma culture supernatant

Notes



DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Neuropeptide Y Antibody (904032) [DyLight 650]

  • 170 kDa melanoma membrane-bound gelatinase
  • DKFZp686G13158
  • DPPIV
  • EC 3.4.21.-
  • FAPA
  • Fibroblast activation protein alpha
  • fibroblast activation protein, alpha
  • Integral membrane serine protease
  • Neuropeptide Y
  • NPY
  • PYY4
  • seprase

Background

NPY a 36 amino acid peptide amide isolated from porcine brain, is a major regulatory neuropeptide in the mammalian central and peripheral nervous systems. NPY belongs to the pancreatic polypeptide family of peptides which are characterized by a common tertiary structure. Within this family, an intestinal peptide hormone, peptide YY (PYY), is most closely related to NPY. In the central nervous system (CNS) NPY is considered to be involved in regulation of blood pressure, memory processing, circadian rhythm, and stimulation of food intake. In the peripheral nervous system (PNS), NPY evokes potent vasoconstrictor activity and acts as a transmitter/neuromodulator of sympathetic neurons and adrenal glands. NPY is one of the most abundant peptides found in the CNS. NPY and NPY mRNA are widely distributed in the brain. High levels of NPY are present in the cerebral cortex, amygdaloid nuclei, hippocampal formation, and hypothalamus. In the PNS, NPY is widely distributed in sympathetic neurons that innervate vascular smooth muscle, heart, and urogenital tract. In these neurons NPY is mainly co-localized with norepinephrine and is considered to function as a neurotransmitter to presynaptically inhibit nor adrenergic neurotransmission. The biological actions of NPY in the brain and periphery are mediated by at least two different NPY receptors, designated Y1 and Y2 receptor subtypes. Cardiovascular effects and centrally evoked food intake potential are activities predominantly mediated by the Y1 receptors, whereas the Y2 receptors, the major subtype in the CNS, are mainly involved in the pre-synaptic inhibition of neurotransmitter release and facilitation of memory retention. Post-synaptic NPY receptors are apparently of both the Y1 and Y2 type. NPY receptors are coupled to at least two different signal transduction mechanisms, the adenylate cyclase pathway (decrease in cAMP), and the phosphoinositol/IP3 pathway. Antibodies that react specifically with NPY are useful for the study of the mode of action, differential tissue expression, and intracellular and subcellular localization of NPY in the central and peripheral nervous systems.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-82390
Species: Hu
Applications: ELISA
NBP1-80865
Species: Hu
Applications: IHC,  IHC-P
DLP00
Applications: ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF1052
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
NBP3-18225
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF704
Applications: IHC, WB
NBP2-33903
Species: Hu
Applications: IHC,  IHC-P
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
FAB8517W
Applications: IHC

Publications for Neuropeptide Y Antibody (FAB8517W) (0)

There are no publications for Neuropeptide Y Antibody (FAB8517W).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuropeptide Y Antibody (FAB8517W) (0)

There are no reviews for Neuropeptide Y Antibody (FAB8517W). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neuropeptide Y Antibody (FAB8517W) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuropeptide Y Products

Research Areas for Neuropeptide Y Antibody (FAB8517W)

Find related products by research area.

Blogs on Neuropeptide Y

There are no specific blogs for Neuropeptide Y, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuropeptide Y Antibody (904032) [DyLight 650] and receive a gift card or discount.

Bioinformatics

Gene Symbol NPY