Neuropeptide Y Antibody (904032) [Alexa Fluor® 405] Summary
| Immunogen |
Neuropeptide Y/NPY conjugated to KLH YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY Accession # P01303 |
| Specificity |
Detects human Neuropeptide Y/NPY in direct ELISAs. |
| Source |
N/A |
| Isotype |
IgG2a |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Purity Statement |
Protein A or G purified from hybridoma culture supernatant |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 °C as supplied |
| Buffer |
Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide. |
Notes
This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.
This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.
Alternate Names for Neuropeptide Y Antibody (904032) [Alexa Fluor® 405]
Background
Neuropeptide Y (NPY) is a 36 amino acid peptide that was isolated from hypothalamus in porcine brain in 1982 and lately it belongs to a family of peptides which include Pancreatic Polypeptide (PP) and Peptide YY (PYY) which exert their pharmacological action via interaction with G-protein coupled receptors Y1, Y2, Y4, Y5 and y6. NPY is the most abundant peptide in brain and in nervous system NPY functions as a neurotransmitter regulating many processes including memory and learning, pain, fat storage and blood pressure. NPY also regulates stress by stimulating secretion of corticotropin-releasing hormone in brain. It appears there is a correlation between the increased levels of NPY gene expression in hippocampus and epileptic seizures. Cocaine reduces the levels of NPY and such a decrease is thought to be related to depression and anxiety. NPY receptors are rhodopsin-like G-protein coupled receptors (GPCR) coupled to Gi or G0 proteins, which inhibit adenylate cyclase and reduce cAMP accumulation and modulate Calcium and Potassium channels.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC
Publications for Neuropeptide Y Antibody (FAB8517V) (0)
There are no publications for Neuropeptide Y Antibody (FAB8517V).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neuropeptide Y Antibody (FAB8517V) (0)
There are no reviews for Neuropeptide Y Antibody (FAB8517V).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Neuropeptide Y Antibody (FAB8517V) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Neuropeptide Y Products
Blogs on Neuropeptide Y