We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Neuropeptide Y Antibody (904032) [Alexa Fluor® 647]

Images

 
There are currently no images for Neuropeptide Y Antibody (FAB8517R).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Applications IHC
Clone
904032
Clonality
Monoclonal
Host
Mouse
Conjugate
Alexa Fluor 647

Order Details

Neuropeptide Y Antibody (904032) [Alexa Fluor® 647] Summary

Immunogen
Neuropeptide Y/NPY conjugated to KLH
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Accession # P01303
Specificity
Detects human Neuropeptide Y/NPY in direct ELISAs.
Source
N/A
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Purity Statement
Protein A or G purified from hybridoma culture supernatant
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry

Packaging, Storage & Formulations

Storage
Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 °C as supplied
Buffer
Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide.

Notes


This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Neuropeptide Y Antibody (904032) [Alexa Fluor® 647]

  • 170 kDa melanoma membrane-bound gelatinase
  • DKFZp686G13158
  • DPPIV
  • EC 3.4.21.-
  • FAPA
  • Fibroblast activation protein alpha
  • fibroblast activation protein, alpha
  • Integral membrane serine protease
  • Neuropeptide Y
  • NPY
  • PYY4
  • seprase

Background

Neuropeptide Y (NPY) is a 36 amino acid peptide that was isolated from hypothalamus in porcine brain in 1982 and lately it belongs to a family of peptides which include Pancreatic Polypeptide (PP) and Peptide YY (PYY) which exert their pharmacological action via interaction with  G-protein coupled receptors Y1, Y2, Y4, Y5 and y6. NPY is the most abundant peptide in brain and in nervous system NPY functions as a neurotransmitter regulating many processes including memory and learning, pain, fat storage and blood pressure. NPY also regulates stress by stimulating secretion of corticotropin-releasing hormone in brain. It appears there is a correlation between the increased levels of NPY gene expression in hippocampus and epileptic seizures. Cocaine reduces the levels of NPY and such a decrease is thought to be related to depression and anxiety. NPY receptors are  rhodopsin-like G-protein coupled receptors (GPCR) coupled to Gi or G0 proteins, which inhibit adenylate cyclase and reduce cAMP accumulation and modulate Calcium and Potassium channels.      

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-82390
Species: Hu
Applications: ELISA
NBP1-80865
Species: Hu
Applications: IHC,  IHC-P
DLP00
Applications: ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-93797
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
AF1052
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
NBP3-18225
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF704
Applications: IHC, WB
NBP2-33903
Species: Hu
Applications: IHC,  IHC-P
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
FAB8517R
Applications: IHC

Publications for Neuropeptide Y Antibody (FAB8517R) (0)

There are no publications for Neuropeptide Y Antibody (FAB8517R).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuropeptide Y Antibody (FAB8517R) (0)

There are no reviews for Neuropeptide Y Antibody (FAB8517R). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neuropeptide Y Antibody (FAB8517R) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuropeptide Y Antibody (904032) [Alexa Fluor® 647] and receive a gift card or discount.

Bioinformatics

Uniprot