Home » Neuroglobin » Neuroglobin Antibodies » Neuroglobin Antibody

Neuroglobin Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Neuroglobin Antibody [NBP2-48769] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Neuroglobin Antibody [NBP2-48769] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Neuroglobin Antibody [NBP2-48769] - Staining of human adrenal gland shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Neuroglobin Antibody [NBP2-48769] - Staining in human adrenal gland and pancreas tissues using anti-NGB antibody. Corresponding NGB RNA-seq data are presented ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Neuroglobin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAA
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NGB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neuroglobin Recombinant Protein Antigen (NBP2-48769PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuroglobin Antibody

  • neuroglobin

Background

The Neuroglobin gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myoglobin Antibody
G-125-C
Myoglobin Antibody
Species: Hu
Applications:
Cytoglobin
Antibody (1A1)
H00114757-M02
Immunocytochemistry/Immunofluorescence: Cytoglobin Antibody (1A1) [H00114757-M02] - Analysis of monoclonal antibody to CYGB on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Cytoglobin Antibody (1A1) [H00114757-M02] - Analysis of monoclonal antibody to CYGB on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.
Western Blot: Cytoglobin Antibody (1A1) [H00114757-M02] - Analysis of CYGB expression in transfected 293T cell line by CYGB monoclonal antibody (M02), clone 1A1.Lane 1: CYGB transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
(5 Publications)
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.
Flow Cytometry: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - Analysis using the Alexa Fluor(R) 488 conjugate of NB100-105. Staining of HIF-1 alpha in H929 cells using HIF-1 alpha antibody. Flow cytometry image submitted by a verified customer review.
Flow Cytometry: HIF-1 alpha Antibody (H1alpha67) [NB100-105] - Analysis using the Alexa Fluor (R) 488 conjugate of NB100-105. Staining of HIF-1 alpha in multiple myeloma cells: H929 cells (0.5 x 10^6) were stained with Alexa Fluor 488(R) conjugated HIF-1 alpha antibody (NB100-105AF488). Image courtesy of Dr. Barbara Muz at Washington University in St. Louis School of Medicine.
(45 Reviews)
(948 Publications)
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Dopamine D3R/DRD3
Antibody
NBP3-12391
Western Blot: Dopamine D3R/DRD3 Antibody [NBP3-12391] - 1:750 antibody dilution in DiluOBuffer. Predicted bad size 50 KDa. Observed band size 50 KDa.
Immunocytochemistry/Immunofluorescence: Dopamine D3R/DRD3 Antibody [NBP3-12391] - PC12 cells. Cells were incubated with primary antibody 5 ug/ml overnight at 4c.
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Using the Alexa Fluor 488 direct conjugate, an intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503AF488 (blue) and a matched isotype control NBP2-27231AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): Cytochrome c Antibody (7H8.2C12) [NB100-56503] - An intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Metformin activates apoptotic cell death; Right panel: MCF-7 cells were kept in the presence or absence of metformin for 20 days and then processed to obtain mitochondrial or whole cellular extracts. BAX and CYCS expression levels were determined by Western blot as indicated under Material and Methods. Densitometric analysis of the gels was performed as indicated under Material and Methods. PHB and CDK4 were used as purity and loading controls. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/2073-4409/8/1/49), licensed under a CC-BY licence.
(59 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
SUCLG1 Antibody
NBP1-32728
Immunocytochemistry/Immunofluorescence: SUCLG1 Antibody [NBP1-32728] - Sample: HeLa cells were fixed in 2% paraformaldehyde/culture medium at 37C for 30 min. Green: SUCLG1 protein stained by SUCLG1 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: SUCLG1 Antibody [NBP1-32728] - N87 xenograft, using SUCLG1antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: SUCLG1 Antibody [NBP1-32728] - Sample (20 ug of whole cell lysate) A: mouse brain 10% SDS PAGE; antibody diluted at 1:10000.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(18 Publications)
Species: Hu
Applications: BA
VEGF [HRP]
DVE00
(625 Publications)
Species: Hu
Applications: ELISA
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Flow Cytometry: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of 10^6 Jurkat cells stained using HO-1 monoclonal antibody (HO-1-1), (Prod. No. ADI-OSA-110), at a concentration of 50 ug/mL
Immunohistochemistry-Paraffin: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of human spleen tissue stained with HO-1, mAb (HO-1-1) at 10ug/ml.
Western Blot: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Lane 1: MW marker; Lane 2: HO-1 (rat), (recombinant); Lane 3: HO-1 (human), (recombinant); Lane 4: HO-2 (human), (recombinant); Lane 5: MDBK cell lysate; Lane 6: Dog liver microsome; Lane 7: Mouse liver microsome.
(1 Review)
(18 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Muscarinic
Acetylcholine Recepto ...
NBP1-87466
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human pancreas shows low expression as expected.
Immunocytochemistry/Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of dissociated rat hippocampal culture. Image submitted by a verified customer review.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
FGFR1 Antibody
(M19B2) - BSA Free
NB600-1287
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis using the Alexa Fluor 488 (R) conjugate of NB600-1287. Staining of FGF R1 in HEK293 and HEK293 FGFR transfected cells using anti-FGF R1 antibody. (Red) Positive cells, (Green) Negative cells, (Blue) Negative cells + antibody, (Pink) Positive cells + antibody. Image from verified customer review.
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Intracellular flow cytometric staining of 1 x 10^6 HEK-293 cells using FGF R1 antibody (Dark Blue) and Isotype control (Orange). An antibody concentration of 1 ug/1x10^6 cells was used.
Western Blot: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis of MCF7 (A), HepG2 (B), NIH3T3 (C), and PC-12 (D) cell lysate using FGF R1 antibody at 2 ug/ml.
(1 Review)
(7 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Cystatin C [HRP]
MSCTC0
(30 Publications)
Species: Mu, Rt
Applications: ELISA
Nrf2 Antibody
NBP1-32822
Western Blot: Nrf2 Antibody [NBP1-32822] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with NRF2 antibody [N2C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Nrf2 Antibody [NBP1-32822] - Untreated (-) and treated (+) RAW264.7 whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with NRF2 antibody [N2C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Nrf2 Antibody [NBP1-32822] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with NRF2 antibody [N2C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
(4 Reviews)
(47 Publications)
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Erythropoietin/EPO
[HRP]
MEP00B
(98 Publications)
Species: Mu
Applications: ELISA
ROS Antibody
(OTI1F3)
NBP2-45626
Immunohistochemistry: ROS Antibody (OTI1F3) [NBP2-45626] - Analysis of Carcinoma Human lung tissue.
Immunohistochemistry: ROS Antibody (OTI1F3) [NBP2-45626] - Analysis of Carcinoma Human lung tissue.
Immunohistochemistry: ROS Antibody (OTI1F3) [NBP2-45626] - Analysis of Human carcinoma lung tissue.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Neuroglobin
Antibody
NBP2-48769
Neuroglobin Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Neuroglobin Antibody (NBP2-48769) (0)

There are no publications for Neuroglobin Antibody (NBP2-48769).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuroglobin Antibody (NBP2-48769) (0)

There are no reviews for Neuroglobin Antibody (NBP2-48769). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neuroglobin Antibody (NBP2-48769) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuroglobin Products

Bioinformatics Tool for Neuroglobin Antibody (NBP2-48769)

Discover related pathways, diseases and genes to Neuroglobin Antibody (NBP2-48769). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuroglobin Antibody (NBP2-48769)

Discover more about diseases related to Neuroglobin Antibody (NBP2-48769).
 

Pathways for Neuroglobin Antibody (NBP2-48769)

View related products by pathway.

PTMs for Neuroglobin Antibody (NBP2-48769)

Learn more about PTMs related to Neuroglobin Antibody (NBP2-48769).
 

Research Areas for Neuroglobin Antibody (NBP2-48769)

Find related products by research area.

Blogs on Neuroglobin

There are no specific blogs for Neuroglobin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuroglobin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NGB