Neuroglobin Antibody

Images

 
Immunohistochemistry-Paraffin: Neuroglobin Antibody [NBP2-48769] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Neuroglobin Antibody [NBP2-48769] - Staining of human adrenal gland shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Neuroglobin Antibody [NBP2-48769] - Staining in human adrenal gland and pancreas tissues using anti-NGB antibody. Corresponding NGB RNA-seq data are presented ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Neuroglobin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAA
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NGB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neuroglobin Recombinant Protein Antigen (NBP2-48769PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuroglobin Antibody

  • neuroglobin

Background

The Neuroglobin gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

G-125-C
Species: Hu
Applications:
H00114757-M02
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NBP3-12391
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
664-LI/CF
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
MSCTC0
Species: Mu, Rt
Applications: ELISA
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
MEP00B
Species: Mu
Applications: ELISA
NBP2-45626
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-48769
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Neuroglobin Antibody (NBP2-48769) (0)

There are no publications for Neuroglobin Antibody (NBP2-48769).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuroglobin Antibody (NBP2-48769) (0)

There are no reviews for Neuroglobin Antibody (NBP2-48769). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neuroglobin Antibody (NBP2-48769) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuroglobin Products

Bioinformatics Tool for Neuroglobin Antibody (NBP2-48769)

Discover related pathways, diseases and genes to Neuroglobin Antibody (NBP2-48769). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuroglobin Antibody (NBP2-48769)

Discover more about diseases related to Neuroglobin Antibody (NBP2-48769).
 

Pathways for Neuroglobin Antibody (NBP2-48769)

View related products by pathway.

PTMs for Neuroglobin Antibody (NBP2-48769)

Learn more about PTMs related to Neuroglobin Antibody (NBP2-48769).
 

Research Areas for Neuroglobin Antibody (NBP2-48769)

Find related products by research area.

Blogs on Neuroglobin

There are no specific blogs for Neuroglobin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuroglobin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NGB