NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free Summary
| Immunogen |
NEU1 (NP_000425, 334 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
NEU1 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free
Background
The EGF receptor family comprises several related receptor tyrosine kinases that are frequently overexpressed in a variety of carcinomas. Members of this receptor family include EGFR (HER1), Neu (ErbB-2, HER2), ErbB-3 (HER3) and ErbB-4 (HER4), which form either homodimers or heterodimers upon ligand binding. Neu, a glycoprotein, undergoes transactivation upon heterodimerization with other EGF receptor family members. Neu heterodimerization with ErbB-3 recruits heregulin, which induces phosphoinositide (PI) 3-kinase activation. Activation of Neu potentiates tumor cell motility and protease secretion and invasion, and also modulates cell cycle checkpoint function, DNA repair and apoptotic responses. Amplification and/or overexpression of Neu occurs in 20-30% of breast carcinomas. Measurement of increased Neu expression can be a predictor of disease prognosis. Neu may also prove to be a promising target for therapeutic agents.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
Publications for NEU-1/Sialidase-1 Antibody (H00004758-M01-100ug) (0)
There are no publications for NEU-1/Sialidase-1 Antibody (H00004758-M01-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NEU-1/Sialidase-1 Antibody (H00004758-M01-100ug) (0)
There are no reviews for NEU-1/Sialidase-1 Antibody (H00004758-M01-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NEU-1/Sialidase-1 Antibody (H00004758-M01-100ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NEU-1/Sialidase-1 Products
Array H00004758-M01-100ug
Blogs on NEU-1/Sialidase-1