NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug] - Detection against Immunogen (34.76 KDa) .

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug] - NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in Raw 264.7.

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug] - NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in IMR-32.

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug] - NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in PC-12.

ELISA: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug] - Detection limit for recombinant GST tagged NEU1 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 3F9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free (H00004758-M01-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: NEU1 (NP_000425, 334 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NEU1
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free

• Acetylneuraminyl hydrolase
• EC 3.2.1.18
• exo-alpha-sialidase
• FLJ93471
• G9 sialidase
• Lysosomal sialidase
• N-acetyl-alpha-neuraminidase 1
• NANH
• NEU
• NEU1
• NEU-1
• SIAL1
• sialidase 1 (lysosomal sialidase)
• Sialidase-1

Background

The EGF receptor family comprises several related receptor tyrosine kinases that are frequently overexpressed in a variety of carcinomas. Members of this receptor family include EGFR (HER1), Neu (ErbB-2, HER2), ErbB-3 (HER3) and ErbB-4 (HER4), which form either homodimers or heterodimers upon ligand binding. Neu, a glycoprotein, undergoes transactivation upon heterodimerization with other EGF receptor family members. Neu heterodimerization with ErbB-3 recruits heregulin, which induces phosphoinositide (PI) 3-kinase activation. Activation of Neu potentiates tumor cell motility and protease secretion and invasion, and also modulates cell cycle checkpoint function, DNA repair and apoptotic responses. Amplification and/or overexpression of Neu occurs in 20-30% of breast carcinomas. Measurement of increased Neu expression can be a predictor of disease prognosis. Neu may also prove to be a promising target for therapeutic agents.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEU1
• Entrez:
  • 4758(Human)
• OMIM:
  • 256550(Human)
• Uniprot:
  • NP_000425(Human)