Netrin-4 Antibody - BSA Free

Western Blot: Netrin-4 Antibody [NBP1-91343] - Suggested Antibody Titration: 0.2-1 ug/ml Positive Control: MCF7 cell lysate

Immunohistochemistry-Paraffin: Netrin-4 Antibody [NBP1-91343] - Rat and mouse brain, 10 ug/ml. Observed staining in cytoplasmin neurons

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Netrin-4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human Netrin-4. Peptide sequence EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NTN4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Netrin-4 Antibody - BSA Free

• beta-Netrin
• hepar-derived netrin-like protein
• netrin 4
• Netrin4
• Netrin-4
• NTN4
• PRO3091

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Netrin-4 Antibody (NBP1-91343)(1)

Publication using NBP1-91343

• Wu Z, Liu S, Pang G, Jiang H RNA?binding protein quaking 5 inhibits the progression of non?small cell lung cancer by upregulating netrin?4 expression Oncology reports 2023-11-01 [PMID: 37800632] (IHC, WB, Human)

Bioinformatics

• Gene Symbol: NTN4
• Uniprot:
  • NP_067052()