Netrin-1 Antibody (5H8)

Images

 
Western Blot: Netrin-1 Antibody (5H8) [H00009423-M01] - Detection against Immunogen (37.84 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Netrin-1 Antibody (5H8) Summary

Immunogen
NTN1 (NP_004813, 495 a.a. ~ 604 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKKA
Specificity
This product is specific for Human NTN1 monoclonal antibody (M01), clone 5H8 [Gene ID: 9423].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NTN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Western Blot 1:100-1:2000
Application Notes
Mouse monoclonal antibody raised against a partial recombinant NTN1.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Netrin-1 Antibody (5H8)

  • netrin 1
  • Netrin1
  • Netrin-1
  • NTN1
  • NTN1Lnetrin 1, mouse, homolog of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF844
Species: Mu
Applications: Block, WB
AF1006
Species: Rt
Applications: IHC, WB
AF1005
Species: Hu
Applications: IHC, WB
AF1079
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
1250-S3
Species: Hu
Applications: BA, BA
5444-SL
Species: Mu
Applications: BA
MAB3629
Species: Mu
Applications: IHC
AF1405
Species: Rt
Applications: Block, ICC, WB
6514-SL
Species: Hu
Applications: BA
1845-SH/CF
Species: Hu
Applications: BA
DBD00
Species: Hu
Applications: ELISA
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF1166
Species: Mu
Applications: WB
DVE00
Species: Hu
Applications: ELISA
NBP1-81399
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
DY1857
Species: Mu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Publications for Netrin-1 Antibody (H00009423-M01) (0)

There are no publications for Netrin-1 Antibody (H00009423-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Netrin-1 Antibody (H00009423-M01) (0)

There are no reviews for Netrin-1 Antibody (H00009423-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Netrin-1 Antibody (H00009423-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Netrin-1 Products

Bioinformatics Tool for Netrin-1 Antibody (H00009423-M01)

Discover related pathways, diseases and genes to Netrin-1 Antibody (H00009423-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Netrin-1 Antibody (H00009423-M01)

Discover more about diseases related to Netrin-1 Antibody (H00009423-M01).
 

Pathways for Netrin-1 Antibody (H00009423-M01)

View related products by pathway.

PTMs for Netrin-1 Antibody (H00009423-M01)

Learn more about PTMs related to Netrin-1 Antibody (H00009423-M01).
 

Research Areas for Netrin-1 Antibody (H00009423-M01)

Find related products by research area.

Blogs on Netrin-1

There are no specific blogs for Netrin-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Netrin-1 Antibody (5H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol NTN1
Uniprot