Home » Netrin-1 » Netrin 1 Research Products » Netrin-1 Antibody (5H8)

Netrin-1 Antibody (5H8)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Netrin-1 Antibody (5H8) [H00009423-M01] - Detection against Immunogen (37.84 KDa) .
Western Blot: Netrin-1 Antibody (5H8) [H00009423-M01] - Detection against Immunogen (37.84 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Netrin-1 Antibody (5H8) Summary

Immunogen
NTN1 (NP_004813, 495 a.a. ~ 604 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKKA
Specificity
This product is specific for Human NTN1 monoclonal antibody (M01), clone 5H8 [Gene ID: 9423].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NTN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Western Blot 1:100-1:2000
Application Notes
Mouse monoclonal antibody raised against a partial recombinant NTN1.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Netrin-1 Antibody (5H8)

  • netrin 1
  • Netrin1
  • Netrin-1
  • NTN1
  • NTN1Lnetrin 1, mouse, homolog of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCC Antibody
AF844
DCC Antibody
(7 Publications)
Species: Mu
Applications: Block, WB
UNC5H2/UNC5B
Antibody [Unconjugate
AF1006
Western blot shows lysates of rat spinal cord tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Rat UNC5H2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1006) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for UNC5H2 at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(12 Publications)
Species: Rt
Applications: IHC, WB
UNC5H3/UNC5C
Antibody [Unconjugate
AF1005
UNC5H3 was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human UNC5H3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1005) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in convoluted tubules. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Publication)
Species: Hu
Applications: IHC, WB
Neogenin Antibody
[Unconjugated]
AF1079
Neogenin was detected in perfusion fixed frozen sections of mouse embryo (15 d.p.c.) using Goat Anti-Human/Mouse Neogenin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1079) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing neurons. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of 3T3‑L1 mouse embryonic fibroblast adipose-like cell line, Jurkat human acute T cell leukemia cell line, and Hepa 1‑6 mouse hepatoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Neogenin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1079) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Neogenin at approximately 230 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of beta TC‑6 mouse beta cell insulinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Neogenin at approximately 207 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse Neogenin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1079) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
Semaphorin 3A
[Unconjugated]
1250-S3
RecombinantHuman Semaphorin 3A Fc Chimera binds to Recombinant Rat Neuropilin-1 Fc Chimerain an ELISA Binding Assay. When Recombinant Rat Neuropilin‑1 Fc Chimera (Catalog # 566-N1) is coated at 2µg/ml, Recombinant Human Semaphorin 3A Fc Chimera (Catalog # 1250-S3) binds with anED50= 50-300 ng/mL.
(2 Reviews)
(32 Publications)
Species: Hu
Applications: BA, BA
Slit2
[Unconjugated]
5444-SL
Slit2 [Unconjugated]
(2 Reviews)
(12 Publications)
Species: Mu
Applications: BA
Slit3 Antibody
(782619)
MAB3629
Slit3 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using Rat Anti-Mouse Slit3 Monoclonal Antibody (Catalog # MAB3629) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). Specific staining was localized to developing muscle cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu
Applications: IHC
UNC5H1/Unc5a
Antibody [Unconjugate
AF1405
UNC5H1 was detected in immersion fixed rat cortical stem cells differentiated by growth factor withdrawal for 7 days using Goat Anti-Rat UNC5H1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1405) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(1 Publication)
Species: Rt
Applications: Block, ICC, WB
Slit1
[Unconjugated]
6514-SL
Slit1 [Unconjugated]
(2 Publications)
Species: Hu
Applications: BA
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH/CF
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog #1845-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
(47 Publications)
Species: Hu
Applications: BA
BDNF [HRP]
DBD00
(4 Reviews)
(69 Publications)
Species: Hu
Applications: ELISA
FAK Antibody
(SR46-04)
NBP2-67327
Flow Cytometry: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of Hela cells with FAK antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: FAK Antibody (SR46-04) [NBP2-67327] - Staining FAK in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of paraffin-embedded human spleen tissue using anti-FAK antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Netrin-G1a Antibody
AF1166
Netrin-G1a Antibody
(3 Publications)
Species: Mu
Applications: WB
VEGF [HRP]
DVE00
(26 Reviews)
(580 Publications)
Species: Hu
Applications: ELISA
ROBO2 Antibody
NBP1-81399
Immunocytochemistry/Immunofluorescence: ROBO2 Antibody [NBP1-81399] - Staining of human cell line SH-SY5Y shows localization to nucleus. Antibody staining is shown in green.
Western Blot: ROBO2 Antibody [NBP1-81399] - Analysis in human cell line HEL.
Immunohistochemistry-Paraffin: ROBO2 Antibody [NBP1-81399] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in neuropil.
(3 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Lipocalin-2/NGAL
[Biotin]
DY1857
(7 Reviews)
(79 Publications)
Species: Mu
Applications: ELISA
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.
Species: Hu
Applications: IHC, IHC-P, WB
Rhodopsin Antibody
(B630)
NBP2-25160
Immunohistochemistry: Rhodopsin Antibody (B630) [NBP2-25160] - Rhodopsin expression and the prevalence of rod photoreceptors in the canine retina. (A) Fluorescence micrographs showing rhodopsin expression (red) in the ABCA4+/+ (left), ABCA4+/- (middle), and ABCA4-/- (right) rod outer segments. Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Western blot analyses of ABCA4 (above), GAPDH (middle), and RHO (below) protein levels in retinal tissue of dogs with the three different genotypes. Image collected and cropped by CiteAb from the following publication. 50 ug of protein samples were resolved by SDS-PAGE, transferred to nitrocellulose membrane, and immunoblotted with the following primary antibodies: ABCA4 (NBP1-30032, 1:1000) and Rhodopsin (NBP2-25160, 1:5000), followed by Anti-Mouse IgG horseradish peroxidase-conjugated secondary antibody (R&D Systems, HAF007, 1:5000. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(4 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(169 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Publications for Netrin-1 Antibody (H00009423-M01) (0)

There are no publications for Netrin-1 Antibody (H00009423-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Netrin-1 Antibody (H00009423-M01) (0)

There are no reviews for Netrin-1 Antibody (H00009423-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Netrin-1 Antibody (H00009423-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Netrin-1 Products

Bioinformatics Tool for Netrin-1 Antibody (H00009423-M01)

Discover related pathways, diseases and genes to Netrin-1 Antibody (H00009423-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Netrin-1 Antibody (H00009423-M01)

Discover more about diseases related to Netrin-1 Antibody (H00009423-M01).
 

Pathways for Netrin-1 Antibody (H00009423-M01)

View related products by pathway.

PTMs for Netrin-1 Antibody (H00009423-M01)

Learn more about PTMs related to Netrin-1 Antibody (H00009423-M01).
 

Research Areas for Netrin-1 Antibody (H00009423-M01)

Find related products by research area.

Blogs on Netrin-1

There are no specific blogs for Netrin-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Netrin-1 Antibody (5H8) and receive a gift card or discount.


Bioinformatics

Gene Symbol NTN1
Uniprot