NET1 Antibody

Images

 
Western Blot: NET1 Antibody [NBP2-13653] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-380
Immunocytochemistry/ Immunofluorescence: NET1 Antibody [NBP2-13653] - Staining of human cell line HaCaT shows localization to nucleus & vesicles.
Immunohistochemistry-Paraffin: NET1 Antibody [NBP2-13653] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NET1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQP GIRRARDKALSGGKRKETL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NET1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NET1 Protein (NBP2-13653PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NET1 Antibody

  • ARHGEF8neuroepithelial cell-transforming gene 1 protein
  • guanine nucleotide regulatory protein (oncogene)
  • NET1A
  • neuroepithelial cell transforming 1
  • neuroepithelial cell transforming gene 1
  • neuroepithelioma transforming gene 1
  • p65 Net1 proto-oncogene protein
  • Proto-oncogene p65 Net1
  • Rho guanine nucleotide exchange factor (GEF) 8
  • Rho guanine nucleotide exchange factor 8
  • small GTP-binding protein regulator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4457
Species: Hu, Mu, Rt
Applications: WB
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
H00001815-R02
Species: Hu
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24517
Species: Hu, Rt, Bv, Pm
Applications: WB, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13653
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NET1 Antibody (NBP2-13653) (0)

There are no publications for NET1 Antibody (NBP2-13653).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NET1 Antibody (NBP2-13653) (0)

There are no reviews for NET1 Antibody (NBP2-13653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NET1 Antibody (NBP2-13653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NET1 Products

Bioinformatics Tool for NET1 Antibody (NBP2-13653)

Discover related pathways, diseases and genes to NET1 Antibody (NBP2-13653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NET1 Antibody (NBP2-13653)

Discover more about diseases related to NET1 Antibody (NBP2-13653).
 

Pathways for NET1 Antibody (NBP2-13653)

View related products by pathway.

PTMs for NET1 Antibody (NBP2-13653)

Learn more about PTMs related to NET1 Antibody (NBP2-13653).

Blogs on NET1

There are no specific blogs for NET1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NET1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NET1