NEK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NEK1 Antibody [NBP1-82883] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane.
Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82883] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEK1 Protein (NBP1-82883PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEK1 Antibody

  • DKFZp686D06121
  • DKFZp686K12169
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA1901MGC138800
  • Never in mitosis A-related kinase 1
  • NIMA (never in mitosis gene a)-related kinase 1
  • NimA-related protein kinase 1
  • NY-REN-55
  • protein-serine/threonine kinase
  • Renal carcinoma antigen NY-REN-55
  • serine/threonine-protein kinase Nek1
  • SRPS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-47865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83024
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-82539
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-42686
Species: Hu
Applications: WB (-), IHC, IP
NBP1-94086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NEK1 Antibody (NBP1-82883) (0)

There are no publications for NEK1 Antibody (NBP1-82883).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK1 Antibody (NBP1-82883) (0)

There are no reviews for NEK1 Antibody (NBP1-82883). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NEK1 Antibody (NBP1-82883) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEK1 Products

Bioinformatics Tool for NEK1 Antibody (NBP1-82883)

Discover related pathways, diseases and genes to NEK1 Antibody (NBP1-82883). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEK1 Antibody (NBP1-82883)

Discover more about diseases related to NEK1 Antibody (NBP1-82883).
 

Pathways for NEK1 Antibody (NBP1-82883)

View related products by pathway.

PTMs for NEK1 Antibody (NBP1-82883)

Learn more about PTMs related to NEK1 Antibody (NBP1-82883).
 

Research Areas for NEK1 Antibody (NBP1-82883)

Find related products by research area.

Blogs on NEK1

There are no specific blogs for NEK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK1