NEIL2 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
The immunogen for this antibody is NEIL2 - N-terminal region. Peptide sequence GDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGF. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NEIL2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for NEIL2 Antibody - BSA Free
Background
NEIL2 belongs to a class of DNA glycosylases homologous to the bacterial Fpg/Nei family. These glycosylases initiate the first step in base excision repair by cleaving bases damaged by reactive oxygen species and introducing a DNA strand break via the associated lyase reaction.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ch, Hu, Mu
Applications: B/N, ICC/IF, IP, PLA, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: WB
Publications for NEIL2 Antibody (NBP1-98526) (0)
There are no publications for NEIL2 Antibody (NBP1-98526).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NEIL2 Antibody (NBP1-98526) (0)
There are no reviews for NEIL2 Antibody (NBP1-98526).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NEIL2 Antibody (NBP1-98526) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NEIL2 Products
Research Areas for NEIL2 Antibody (NBP1-98526)
Find related products by research area.
|
Blogs on NEIL2