Novus Biologicals products are now on bio-techne.com

NEDP1/SENP8 Antibody

Images

 
Western Blot: NEDP1/SENP8 Antibody [NBP1-85259] - Analysis in control (vector only transfected HEK293T lysate) and SENP8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: NEDP1/SENP8 Antibody [NBP1-85259] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: NEDP1/SENP8 Antibody [NBP1-85259] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEDP1/SENP8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SENP8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEDP1/SENP8 Protein (NBP1-85259PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEDP1/SENP8 Antibody

  • DEN1
  • DEN1deneddylase-1
  • deneddylase 1
  • Deneddylase-1
  • EC 3.4.22.-
  • HsT17512
  • NEDD8-specific protease 1
  • NEDP1
  • NEDP1NEDD8 specific-protease cysteine 2
  • Protease, cysteine 2
  • protease, cysteine, 2 (NEDD8 specific)
  • PRSC2
  • SENP8
  • Sentrin/SUMO-specific protease SENP8
  • sentrin-specific protease 8
  • SUMO sentrin specific protease family member 8
  • SUMO/sentrin specific peptidase family member 8
  • SUMO/sentrin specific protease family member 8

Background

NEDD8 (MIM 603171) is a ubiquitin-like protein that becomes conjugated to the cullin (see CUL1; MIM 603134) subunit of several ubiquitin ligases. This conjugation, called neddylation, is required for optimal ubiquitin ligase activity. NEDD8-specific deneddylases, such as NEDP1, or DEN1, are required to process the NEDD8 propeptide at a C-terminal diglycine motif and to remove NEDD8 from cullins (Gan-Erdene et al., 2003 [PubMed 12759363]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

UL-812
Species: Hu, Mu, Rt
Applications: EnzAct
NBP3-16092
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-86871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86037
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02648
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010920-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NB110-92756
Species: Ch, Hu, Mu, Re
Applications: KD, WB
255-SC
Species: Hu
Applications: BA
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP1-91803
Species: Hu
Applications: IHC, IHC-P, WB

Publications for NEDP1/SENP8 Antibody (NBP1-85259) (0)

There are no publications for NEDP1/SENP8 Antibody (NBP1-85259).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDP1/SENP8 Antibody (NBP1-85259) (0)

There are no reviews for NEDP1/SENP8 Antibody (NBP1-85259). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NEDP1/SENP8 Antibody (NBP1-85259) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEDP1/SENP8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SENP8