NEDD1 Antibody

Images

 
Western Blot: NEDD1 Antibody [NBP1-83377] - Analysis in human cell lines PC-3 and HeLa using Anti-NEDD1 antibody. Corresponding NEDD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: NEDD1 Antibody [NBP1-83377] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEDD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSTPNPKIASSVTAGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGL
Marker
Centrosome Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEDD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NEDD1 Protein (NBP1-83377PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEDD1 Antibody

  • FLJ35902
  • GCP-WD
  • NEDD-1
  • Neural precursor cell expressed developmentally down-regulated protein 1
  • neural precursor cell expressed, developmentally down-regulated 1
  • protein NEDD1
  • TUBGCP7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28718
Species: Hu
Applications: WB, IP
NBP2-53097
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-92547
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59027
Species: Hu
Applications: ICC/IF, IHC-P
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-92217
Species: Hu
Applications: IHC, IHC-P
NBP2-16628
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-16416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-47865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31110
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-83377
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NEDD1 Antibody (NBP1-83377) (0)

There are no publications for NEDD1 Antibody (NBP1-83377).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDD1 Antibody (NBP1-83377) (0)

There are no reviews for NEDD1 Antibody (NBP1-83377). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEDD1 Antibody (NBP1-83377) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEDD1 Products

Bioinformatics Tool for NEDD1 Antibody (NBP1-83377)

Discover related pathways, diseases and genes to NEDD1 Antibody (NBP1-83377). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEDD1 Antibody (NBP1-83377)

Discover more about diseases related to NEDD1 Antibody (NBP1-83377).
 

Pathways for NEDD1 Antibody (NBP1-83377)

View related products by pathway.

PTMs for NEDD1 Antibody (NBP1-83377)

Learn more about PTMs related to NEDD1 Antibody (NBP1-83377).
 

Research Areas for NEDD1 Antibody (NBP1-83377)

Find related products by research area.

Blogs on NEDD1

There are no specific blogs for NEDD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEDD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEDD1