CEP192 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CEP192 Antibody [NBP1-84634] - Staining of human cell line U-251 MG shows positivity in cytoplasm and centrosome.
Immunohistochemistry-Paraffin: CEP192 Antibody [NBP1-84634] - Staining of human testis shows strong cytoplasmic and nuclear staining in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP192 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FVLKERTQENVTLIYNPSDRGINNKTATELSTVYLFGGDEISRQQYRRALLHKPEMIKQILPEHSVLQNINFVEAFQDELLVTEVYD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP192
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CEP192 Protein (NBP1-84634PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-84634 in the following applications:

Publications
Read Publication using
NBP1-84634 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP192 Antibody

  • centrosomal protein 192kDa
  • centrosomal protein of 192 kDa
  • Cep192
  • FLJ10352
  • KIAA1569

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00121441-M05
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-33402
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59027
Species: Hu
Applications: ICC/IF, IHC-P
NBP2-20264
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82953
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-495
Species: Hu
Applications: WB
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-84634
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CEP192 Antibody (NBP1-84634)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for CEP192 Antibody (NBP1-84634) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-84634:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CEP192 NBP1-84634
Enlarge
reviewed by:
Anonymous
WB Human 08/08/2012
View

Summary

ApplicationWestern Blot
Sample TestedHela whole cell lysates
SpeciesHuman
LotR36766
CommentsDespite the lower unspecific band, provides very nice bands at the predicted molecular weight

Blocking

Blocking Details10% milk TBS-Tween 10 minutes

Primary Anitbody

Dilution Ratio1:500 in 2% BSA TBS-T overnight

Secondary Antibody

Secondary Descriptiongoat-anti-rabbit IgG-HRP
Secondary Manufacturer Cat#Cell Signaling tech 7074
Secondary Concentration1:2000

Details

Detection NotesECL, using siRNA mediated knockdown as negative control

Comments

CommentsDespite the lower unspecific band, provides very nice bands at the predicted molecular weight

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CEP192 Antibody (NBP1-84634) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEP192 Products

Bioinformatics Tool for CEP192 Antibody (NBP1-84634)

Discover related pathways, diseases and genes to CEP192 Antibody (NBP1-84634). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP192 Antibody (NBP1-84634)

Discover more about diseases related to CEP192 Antibody (NBP1-84634).
 

Pathways for CEP192 Antibody (NBP1-84634)

View related products by pathway.

PTMs for CEP192 Antibody (NBP1-84634)

Learn more about PTMs related to CEP192 Antibody (NBP1-84634).

Blogs on CEP192

There are no specific blogs for CEP192, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/08/2012
Application: WB
Species: Human

Bioinformatics

Gene Symbol CEP192