CDK5RAP2 Antibody (CL3392)

Immunocytochemistry/Immunofluorescence: CDK5RAP2 Antibody (CL3392) [NBP2-59027] - Staining of U251 cells using the anti-CDK5RAP2 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CDK5RAP2 Antibody (CL3392) [NBP2-59027] - Staining of human kidney shows centrosome-like positivity in renal cells.

Immunocytochemistry/Immunofluorescence: CDK5RAP2 Antibody (CL3392) [NBP2-59027] - Staining of HeLa cells using the anti-CDK5RAP2 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: CDK5RAP2 Antibody (CL3392) [NBP2-59027] - Staining of A431 cells using the anti-CDK5RAP2 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: CDK5RAP2 Antibody (CL3392) [NBP2-59027] - Staining of U2OS cells using the anti-CDK5RAP2 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CDK5RAP2 Antibody (CL3392) [NBP2-59027] - Staining of human breast cancer shows centrosome-like immunoreactivity in tumor cells.

Immunohistochemistry-Paraffin: CDK5RAP2 Antibody (CL3392) [NBP2-59027] - Staining of human testis shows centrosome-like immunoreactivity in a subset of seminiferous epithelium cells.

Immunohistochemistry-Paraffin: CDK5RAP2 Antibody (CL3392) [NBP2-59027] - Staining of human tonsil shows centrosome-like positivity in lymphoid cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clone: CL3392
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

CDK5RAP2 Antibody (CL3392) Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV
• Epitope: YETSEKSFFS
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: CDK5RAP2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CDK5RAP2 Recombinant Protein Antigen (NBP2-59027PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for CDK5RAP2 Antibody (CL3392)

• C48
• CDK5 activator-binding protein C48
• CDK5 regulatory subunit associated protein 2
• CDK5 regulatory subunit-associated protein 2
• centrosomal protein 215 kDa
• Centrosome-associated protein 215
• Cep215
• DKFZp686B1070
• DKFZp686D1070
• FLJ10867
• KIAA1633microcephaly, primary autosomal recessive 3
• MCPH3

Background

CDK5RAP2 is a potential regulator of CDK5 activity via its interaction with CDK5R1. This novel protein is widely expressed in human tissues, including the heart, brain, skeletal muscle, placenta, lung, liver, kidney and pancreas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK5RAP2