Reactivity | HuSpecies Glossary |
Applications | ICC/IF, IHC |
Clone | CL3392 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV |
Epitope | YETSEKSFFS |
Isotype | IgG1 |
Clonality | Monoclonal |
Host | Mouse |
Gene | CDK5RAP2 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for CDK5RAP2 Antibody (NBP2-59027)Discover more about diseases related to CDK5RAP2 Antibody (NBP2-59027).
| Pathways for CDK5RAP2 Antibody (NBP2-59027)View related products by pathway.
|
PTMs for CDK5RAP2 Antibody (NBP2-59027)Learn more about PTMs related to CDK5RAP2 Antibody (NBP2-59027).
| Research Areas for CDK5RAP2 Antibody (NBP2-59027)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CDK5RAP2 |