GCP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GCP4 Antibody [NBP1-90313] - Staining of human cell line A-431 shows positivity in centrosome.
Immunohistochemistry-Paraffin: GCP4 Antibody [NBP1-90313] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILFVGESVQMFENQNVNLTRKGSILKNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDFYLLGRGELFQAFIDTAQHMLKTPPTA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TUBGCP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GCP4 Protein (NBP1-90313PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCP4 Antibody

  • 76PhGCP4
  • FLJ14797
  • gamma tubulin ring complex protein (76p gene)
  • Gamma-ring complex protein 76 kDa
  • gamma-tubulin complex component 4
  • GCP-4
  • GCP4hGrip76
  • h76p
  • tubulin, gamma complex associated protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92547
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53097
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-83380
Species: Hu
Applications: IHC, IHC-P
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00121441-M05
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92548
Species: Hu
Applications: IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
AF3145
Species: Hu
Applications: WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-574
Species: Hu, Mu, Rt, Po, Bv, Ch, Pl, Pr
Applications: WB, ICC/IF
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00027175-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010645-M01
Species: Hu, Mu
Applications: WB, ELISA, IP
NBP1-89771
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GCP4 Antibody (NBP1-90313) (0)

There are no publications for GCP4 Antibody (NBP1-90313).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCP4 Antibody (NBP1-90313) (0)

There are no reviews for GCP4 Antibody (NBP1-90313). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GCP4 Antibody (NBP1-90313) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCP4 Products

Bioinformatics Tool for GCP4 Antibody (NBP1-90313)

Discover related pathways, diseases and genes to GCP4 Antibody (NBP1-90313). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCP4 Antibody (NBP1-90313)

Discover more about diseases related to GCP4 Antibody (NBP1-90313).
 

Pathways for GCP4 Antibody (NBP1-90313)

View related products by pathway.

Blogs on GCP4

There are no specific blogs for GCP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBGCP4