Home » NDUFV2 » NDUFV2 Antibodies » NDUFV2 Antibody

NDUFV2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NDUFV2 Antibody [H00004729-B01P] - Analysis of NDUFV2 expression in human liver.
Western Blot: NDUFV2 Antibody [H00004729-B01P] - Analysis of NDUFV2 expression in human liver.
Western Blot: NDUFV2 Antibody [H00004729-B01P] - Analysis of NDUFV2 expression in transfected 293T cell line by NDUFV2 polyclonal antibody. Lane 1: NDUFV2 transfected lysate(27.39 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NDUFV2 Antibody Summary

Immunogen
NDUFV2 (NP_066552.1, 1 a.a. - 249 a.a.) full-length human protein. MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Specificity
NDUFV2 - NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NDUFV2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFV2 Antibody

  • CI-24k
  • mitochondrial respitory chain, 24 kD subunit
  • NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD)
  • NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
  • NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
  • NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial
  • NADH-ubiquinone oxidoreductase 24 kDa subunit
  • NADH-ubiquinone oxidoreductase flavoprotein 2
  • nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NDUFV1 Antibody
(4A7)
H00004723-M01
Western Blot: NDUFV1 Antibody (4A7) [H00004723-M01] - NDUFV1 monoclonal antibody (M01), clone 4A7. Analysis of NDUFV1 expression in PC-12.
Western Blot: NDUFV1 Antibody (4A7) [H00004723-M01] - Western Blot analysis of NDUFV1 expression in A-431 ( Cat # L015V1 ).
Western Blot: NDUFV1 Antibody (4A7) [H00004723-M01] - Analysis of NDUFV1 over-expressed 293 cell line, cotransfected with NDUFV1 Validated Chimera RNAi ( Cat # H00004723-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFV1 monoclonal antibody (M01), clone 4A7 (Cat # H00004723-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, RNAi
NDUFS3 Antibody
NBP1-85619
Western Blot: NDUFS3 Antibody [NBP1-85619] - Analysis in human cell line MCF-7.
Immunocytochemistry/Immunofluorescence: NDUFS3 Antibody [NBP1-85619] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear bodies & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NDUFS3 Antibody [NBP1-85619] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Ndufs1 Antibody
NBP1-31142
Western Blot: Ndufs1 Antibody [NBP1-31142] - Sample (50 ug of whole cell lysate) A: Mouse brain 7. 5% SDS PAGE; antibody diluted at 1:10000.
Immunohistochemistry-Paraffin: Ndufs1 Antibody [NBP1-31142] - Paraffin-embedded ovarian carcinoma. NDUFS1 antibody dilution: 1:250.
Western Blot: Ndufs1 Antibody [NBP1-31142] - 50 ug mouse brain lysate/extract 7. 5 % SDS-PAGE gel, antibody dilution 1:500.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NCAM-1/CD56
Antibody (123C3 (same ...
NBP2-15184
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - Formalin-fixed, paraffin-embedded human colon Ganglion stained with CD56 Monoclonal Antibody (123C3.D5)
Flow Cytometry: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - Analysis of Alexa Fluor (R) 700 conjugate of NBP2-15184. CD56 in human PBMC using anti-CD56 antibody. The primary antibody was used at a dilution of 1:100, incubated for 25 min at 4C in 2% human serum, 0.5 mM EDTA in DPBS. Image from verified customer rev
Flow Cytometry: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - analysis of CD56 on human monocytes using CD56 antibody at 1 ug/10^6 cells.
(1 Review)
(4 Publications)
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
BDNF [Unconjugated]
248-BD
1 μg/lane of Recombinant Human BDNF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human BDNF (Catalog #248‑BD) stimulates cell proliferation in the BaF mouse pro-B cell line transfected with TrkB. The ED50 for this effect is 0.2-2 ng/mL.
(6 Reviews)
(98 Publications)
Species: Hu, Mu, Rt, Ca, Eq
NDUFS2 Antibody
(OTI1D5)
NBP2-46127
Western Blot: NDUFS2 Antibody (1D5) [NBP2-46127] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY NDUFS2.
Immunohistochemistry: NDUFS2 Antibody (1D5) [NBP2-46127] - Analysis of Human lymph node tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: NDUFS2 Antibody (1D5) [NBP2-46127] - Analysis of A549 cell lysate (35ug) by using NDUFS2 monoclonal antibody.
(1 Publication)
Species: Hu
Applications: WB, IHC
Ndufs4 Antibody
NBP1-89026
Western Blot: Ndufs4 Antibody [NBP1-89026] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Ndufs4 Antibody [NBP1-89026] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: Ndufs4 Antibody [NBP1-89026] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Recombinant Human
NDUFS7 Protein
H00374291-P01
SDS-Page: Recombinant Human NDUFS7 Protein [H00374291-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
NDUFB6 Antibody
NBP1-92172
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Calbindin D-28K
Antibody (4H7)
NBP2-50048
Western Blot: Calbindin D-28K Antibody (4H7) [NBP2-50048] - Analysis of cow cerebellum lysate were probed with NBP2-50048. NBP2-50048 binds strongly and specifically to Calbindin at 28 kDa.
Immunocytochemistry/Immunofluorescence: Calbindin D-28K Antibody (4H7) [NBP2-50048] - Analysis of rat brain cerebellum section stained with mouse mAb to calbindin, NBP2-50048, dilution 1:1,000, in green, and costained with rabbit pAb to calretinin, dilution 1:5,000 in red. The blue is DAPI staining of nuclear DNA Following transcardial perfusion with 4% paraformaldehyde, brain was post fixed for 24 hours, cut to 45uM, and free-floating sections were stained with the above antibodies. Calbindin antibody prominently labels the dendrites and perikarya of Purkinje cells in the molecular layer of cerebellum. In contrast the calretinin antibody stains granule cells, in the granualar layer, and their processes in the molecular layer.
Immunocytochemistry/Immunofluorescence: Calbindin D-28K Antibody (4H7) [NBP2-50048] - Rat brain cerebellum (Middle) and cortex (Right) sections (45 uM; fixed by transcardial perfusion with 4% paraformaldehyde) were co-stained with NBP2-50048 (red) and anti-MeCP2 rabbit antibody (NBP2-50060, green). Calbindin is predominantly expressed in the dendrites and perikarya of Purkinje cells in the molecular layer of cerebellum, and selectively expressed in certain type of interneurons (calbindin-postive interneuron) in the cortex. MeCP2 is universally expressed in the nuclei of almost all neurons. As a result, calbindin-expressing cell is strongly labeled with red in soma, but the nucleus appears to be yellow. Blue is Dapi nucleus staining. Insets are high magnification images of the boxed areas.
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
DISC1 Antibody
NB110-40773
Immunocytochemistry/Immunofluorescence: DISC1 Antibody [NB110-40773] - DISC1 antibody was tested in PC-12 cells at 1:100 with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 549 (red).
Immunohistochemistry: DISC1 Antibody [NB110-40773] - Staining of DISC1 in human brain neurons and neuropil at 2.5ug/ml. 40X.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
RAP1GAP Antibody
NBP1-83002
Immunocytochemistry/Immunofluorescence: RAP1GAP Antibody [NBP1-83002] - Staining of mouse hippocampus shows cytoplasmic positivity in a subset of interneurons in the CA1 area.
Immunohistochemistry-Paraffin: RAP1GAP Antibody [NBP1-83002] - Staining of human cerebellum shows strong cytoplasmic immunoreactivity in Purkinje cells and neurons in the molecular layer.
Immunocytochemistry/Immunofluorescence: RAP1GAP Antibody [NBP1-83002] - Staining of mouse midbrain shows strong immunoreactivity in locus coeruleus neurons.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NDUFA2 Knockout
HeLa Cell Lysate
NBP2-66200
NDUFA2 Knockout HeLa Cell Lysate
Species: Hu
Dysbindin Antibody
NBP1-85299
Western Blot: Dysbindin Antibody [NBP1-85299] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: Dysbindin Antibody [NBP1-85299] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining in human lymph node and pancreas tissues using anti-DTNBP1 antibody. Corresponding DTNBP1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Exosome Component
9 Antibody
NBP1-71702
Western Blot: Exosome Component 9 Antibody [NBP1-71702] - Analysis of EXOSC9 in A. HepG2 cell lysate and B. MCF7 cell lysate.
Immunocytochemistry/Immunofluorescence: Exosome Component 9 Antibody [NBP1-71702] - EXOSC9 antibody was tested at 1:100 in HeLa cells with FITC (green). Nuclei and actin were counterstained with Dapi (blue) and Phalloidin (red).
Immunohistochemistry: Exosome Component 9 Antibody [NBP1-71702] - Staining of EXOSC9 in mouse prostate.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
alpha-Synuclein
Antibody
NBP2-15365
Western Blot: alpha-Synuclein Antibody [NBP2-15365] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with alpha Synuclein antibody diluted at 1:2000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: alpha-Synuclein Antibody [NBP2-15365] - DIV14 rat E18 primary cortical neurons were fixed in 4% paraformaldehyde at RT for 15 min. Green: alpha Synuclein protein stained by alpha Synuclein antibody diluted at 1:500. Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Frozen: alpha-Synuclein Antibody [NBP2-15365] - Frozen-sectioned adult mouse hippocampus. Green: alpha Synuclein protein stained by alpha Synuclein antibody diluted at 1:250. Red: NeuN, stained by NeuN antibody [2Q158] diluted at 1:500.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NDUFS8 Antibody
NBP1-85620
Immunocytochemistry/Immunofluorescence: NDUFS8 Antibody [NBP1-85620] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NDUFS8 Antibody [NBP1-85620] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for NDUFV2 Antibody (H00004729-B01P) (0)

There are no publications for NDUFV2 Antibody (H00004729-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFV2 Antibody (H00004729-B01P) (0)

There are no reviews for NDUFV2 Antibody (H00004729-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFV2 Antibody (H00004729-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NDUFV2 Antibody (H00004729-B01P)

Discover related pathways, diseases and genes to NDUFV2 Antibody (H00004729-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFV2 Antibody (H00004729-B01P)

Discover more about diseases related to NDUFV2 Antibody (H00004729-B01P).
 

Pathways for NDUFV2 Antibody (H00004729-B01P)

View related products by pathway.

PTMs for NDUFV2 Antibody (H00004729-B01P)

Learn more about PTMs related to NDUFV2 Antibody (H00004729-B01P).

Blogs on NDUFV2

There are no specific blogs for NDUFV2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFV2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NDUFV2
Entrez
Uniprot