NDUFV2 Antibody

Images

 
Western Blot: NDUFV2 Antibody [H00004729-B01P] - Analysis of NDUFV2 expression in human liver.
Western Blot: NDUFV2 Antibody [H00004729-B01P] - Analysis of NDUFV2 expression in transfected 293T cell line by NDUFV2 polyclonal antibody. Lane 1: NDUFV2 transfected lysate(27.39 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDUFV2 Antibody Summary

Immunogen
NDUFV2 (NP_066552.1, 1 a.a. - 249 a.a.) full-length human protein. MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Specificity
NDUFV2 - NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NDUFV2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFV2 Antibody

  • CI-24k
  • mitochondrial respitory chain, 24 kD subunit
  • NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD)
  • NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
  • NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
  • NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial
  • NADH-ubiquinone oxidoreductase 24 kDa subunit
  • NADH-ubiquinone oxidoreductase flavoprotein 2
  • nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33074
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-75587
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE, Flow-CS
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP1-89026
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-49846
Species: Hu
Applications: WB, IP, PEP-ELISA
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83002
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-66200
Species: Hu
NBP1-85299
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for NDUFV2 Antibody (H00004729-B01P) (0)

There are no publications for NDUFV2 Antibody (H00004729-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFV2 Antibody (H00004729-B01P) (0)

There are no reviews for NDUFV2 Antibody (H00004729-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFV2 Antibody (H00004729-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NDUFV2 Antibody (H00004729-B01P)

Discover related pathways, diseases and genes to NDUFV2 Antibody (H00004729-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFV2 Antibody (H00004729-B01P)

Discover more about diseases related to NDUFV2 Antibody (H00004729-B01P).
 

Pathways for NDUFV2 Antibody (H00004729-B01P)

View related products by pathway.

PTMs for NDUFV2 Antibody (H00004729-B01P)

Learn more about PTMs related to NDUFV2 Antibody (H00004729-B01P).

Blogs on NDUFV2

There are no specific blogs for NDUFV2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFV2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFV2
Entrez
Uniprot