NDUFV2 Antibody - Azide and BSA Free

Western Blot: NDUFV2 Antibody [H00004729-B01P] - Analysis of NDUFV2 expression in human liver.

Western Blot: NDUFV2 Antibody [H00004729-B01P] - Analysis of NDUFV2 expression in transfected 293T cell line by NDUFV2 polyclonal antibody. Lane 1: NDUFV2 transfected lysate(27.39 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NDUFV2 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: NDUFV2 (NP_066552.1, 1 a.a. - 249 a.a.) full-length human protein. MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
• Specificity: NDUFV2 - NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: NDUFV2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFV2 Antibody - Azide and BSA Free

• CI-24k
• mitochondrial respitory chain, 24 kD subunit
• NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD)
• NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
• NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
• NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial
• NADH-ubiquinone oxidoreductase 24 kDa subunit
• NADH-ubiquinone oxidoreductase flavoprotein 2
• nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit

Background

NDUFV2 is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Complex I is composed of 45 different subunits. This is a component of the flavoprotein-sulfur (FP) fragment of the enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFV2
• Entrez:
  • 4729(Human)
• Uniprot:
  • NP_066552.1(Human)